Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4565520..4566122 | Replicon | chromosome |
Accession | NZ_CP122868 | ||
Organism | Escherichia coli strain ETEC1721 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | QDX04_RS22140 | Protein ID | WP_000897305.1 |
Coordinates | 4565811..4566122 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | QDX04_RS22135 | Protein ID | WP_000356397.1 |
Coordinates | 4565520..4565810 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDX04_RS22110 (4561446) | 4561446..4562348 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
QDX04_RS22115 (4562345) | 4562345..4562980 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
QDX04_RS22120 (4562977) | 4562977..4563906 | + | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
QDX04_RS22125 (4564236) | 4564236..4564478 | - | 243 | WP_001086388.1 | protein YiiF | - |
QDX04_RS22130 (4564697) | 4564697..4564915 | - | 219 | WP_001297075.1 | CopG family transcriptional regulator | - |
QDX04_RS22135 (4565520) | 4565520..4565810 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
QDX04_RS22140 (4565811) | 4565811..4566122 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
QDX04_RS22145 (4566351) | 4566351..4567259 | + | 909 | WP_001162704.1 | alpha/beta hydrolase | - |
QDX04_RS22150 (4567323) | 4567323..4568264 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
QDX04_RS22155 (4568309) | 4568309..4568746 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
QDX04_RS22160 (4568743) | 4568743..4569615 | - | 873 | WP_088555649.1 | virulence factor BrkB family protein | - |
QDX04_RS22165 (4569609) | 4569609..4570208 | - | 600 | WP_001295269.1 | glucose-1-phosphatase | - |
QDX04_RS22170 (4570307) | 4570307..4571092 | - | 786 | WP_000059678.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T278127 WP_000897305.1 NZ_CP122868:c4566122-4565811 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|