Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
| Location | 742788..743481 | Replicon | chromosome |
| Accession | NZ_CP122859 | ||
| Organism | Escherichia coli strain ETEC1720 | ||
Toxin (Protein)
| Gene name | mqsR | Uniprot ID | S1EZG2 |
| Locus tag | QDY31_RS03655 | Protein ID | WP_000415584.1 |
| Coordinates | 742788..743084 (+) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | mqsA | Uniprot ID | S1EBV2 |
| Locus tag | QDY31_RS03660 | Protein ID | WP_000650107.1 |
| Coordinates | 743086..743481 (+) | Length | 132 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDY31_RS03620 (737876) | 737876..738190 | - | 315 | WP_000958598.1 | putative quinol monooxygenase | - |
| QDY31_RS03625 (738221) | 738221..738802 | - | 582 | WP_000065430.1 | NADPH:quinone oxidoreductase MdaB | - |
| QDY31_RS03630 (739121) | 739121..739453 | + | 333 | WP_000917684.1 | DUF2645 family protein | - |
| QDY31_RS03635 (739499) | 739499..740848 | - | 1350 | WP_097340762.1 | quorum sensing histidine kinase QseC | - |
| QDY31_RS03640 (740845) | 740845..741504 | - | 660 | WP_001221493.1 | quorum sensing response regulator transcription factor QseB | - |
| QDY31_RS03645 (741656) | 741656..742048 | + | 393 | WP_282844031.1 | OB fold stress tolerance protein YgiW | - |
| QDY31_RS03650 (742101) | 742101..742583 | + | 483 | WP_000183505.1 | GyrI-like domain-containing protein | - |
| QDY31_RS03655 (742788) | 742788..743084 | + | 297 | WP_000415584.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
| QDY31_RS03660 (743086) | 743086..743481 | + | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
| QDY31_RS03665 (743614) | 743614..745221 | + | 1608 | WP_001295629.1 | ABC transporter substrate-binding protein | - |
| QDY31_RS03670 (745359) | 745359..747617 | + | 2259 | WP_001281881.1 | DNA topoisomerase IV subunit A | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11231.96 Da Isoelectric Point: 8.9070
>T278082 WP_000415584.1 NZ_CP122859:742788-743084 [Escherichia coli]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT278082 WP_000650107.1 NZ_CP122859:743086-743481 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|