Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 584051..584850 | Replicon | chromosome |
| Accession | NZ_CP122859 | ||
| Organism | Escherichia coli strain ETEC1720 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | V0SSH7 |
| Locus tag | QDY31_RS02885 | Protein ID | WP_000347273.1 |
| Coordinates | 584051..584515 (-) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | S1EB98 |
| Locus tag | QDY31_RS02890 | Protein ID | WP_001307405.1 |
| Coordinates | 584515..584850 (-) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDY31_RS02855 (579052) | 579052..579486 | - | 435 | WP_000948842.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
| QDY31_RS02860 (579504) | 579504..580382 | - | 879 | WP_094314169.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
| QDY31_RS02865 (580372) | 580372..581151 | - | 780 | WP_000406209.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
| QDY31_RS02870 (581162) | 581162..581635 | - | 474 | WP_001336162.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| QDY31_RS02875 (581658) | 581658..582938 | - | 1281 | WP_196011018.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| QDY31_RS02880 (583187) | 583187..583996 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
| QDY31_RS02885 (584051) | 584051..584515 | - | 465 | WP_000347273.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| QDY31_RS02890 (584515) | 584515..584850 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| QDY31_RS02895 (584999) | 584999..586570 | - | 1572 | WP_001273753.1 | galactarate dehydratase | - |
| QDY31_RS02900 (586945) | 586945..588279 | + | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
| QDY31_RS02905 (588295) | 588295..589065 | + | 771 | WP_196011017.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17836.25 Da Isoelectric Point: 9.6924
>T278079 WP_000347273.1 NZ_CP122859:c584515-584051 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V0SSH7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XVC7 |