Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 8919..9183 | Replicon | plasmid unnamed3 |
| Accession | NZ_CP122847 | ||
| Organism | Escherichia coli strain ETEC1722 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | U9Y6M3 |
| Locus tag | QDX00_RS23325 | Protein ID | WP_001331364.1 |
| Coordinates | 9031..9183 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 8919..8981 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDX00_RS23310 (5021) | 5021..6091 | - | 1071 | WP_015058906.1 | IncI1-type conjugal transfer protein TrbB | - |
| QDX00_RS23315 (6110) | 6110..7318 | - | 1209 | WP_282835985.1 | IncI1-type conjugal transfer protein TrbA | - |
| - (7498) | 7498..7555 | - | 58 | NuclAT_1 | - | - |
| - (7498) | 7498..7555 | - | 58 | NuclAT_1 | - | - |
| - (7498) | 7498..7555 | - | 58 | NuclAT_1 | - | - |
| - (7498) | 7498..7555 | - | 58 | NuclAT_1 | - | - |
| QDX00_RS23320 (7625) | 7625..8404 | - | 780 | WP_275450201.1 | protein FinQ | - |
| - (8919) | 8919..8981 | - | 63 | NuclAT_0 | - | Antitoxin |
| - (8919) | 8919..8981 | - | 63 | NuclAT_0 | - | Antitoxin |
| - (8919) | 8919..8981 | - | 63 | NuclAT_0 | - | Antitoxin |
| - (8919) | 8919..8981 | - | 63 | NuclAT_0 | - | Antitoxin |
| QDX00_RS23325 (9031) | 9031..9183 | + | 153 | WP_001331364.1 | Hok/Gef family protein | Toxin |
| QDX00_RS23330 (9255) | 9255..9506 | - | 252 | WP_001291964.1 | hypothetical protein | - |
| - (9893) | 9893..9944 | - | 52 | NuclAT_2 | - | - |
| - (9893) | 9893..9944 | - | 52 | NuclAT_2 | - | - |
| - (9893) | 9893..9944 | - | 52 | NuclAT_2 | - | - |
| - (9893) | 9893..9944 | - | 52 | NuclAT_2 | - | - |
| QDX00_RS23335 (10624) | 10624..10719 | + | 96 | WP_001303310.1 | DinQ-like type I toxin DqlB | - |
| QDX00_RS23340 (10784) | 10784..10960 | - | 177 | WP_001054898.1 | hypothetical protein | - |
| QDX00_RS23345 (11292) | 11292..11501 | + | 210 | WP_000062602.1 | HEAT repeat domain-containing protein | - |
| QDX00_RS23350 (11572) | 11572..12234 | - | 663 | WP_000644797.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | aph(4)-Ia / aac(3)-IVa / blaTEM-52B / tet(A) / sul2 / aph(3'')-Ib / aph(6)-Id | - | 1..105315 | 105315 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5775.13 Da Isoelectric Point: 8.7948
>T278069 WP_001331364.1 NZ_CP122847:9031-9183 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
Antitoxin
Download Length: 63 bp
>AT278069 NZ_CP122847:c8981-8919 [Escherichia coli]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|