Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 3702616..3703310 | Replicon | chromosome |
Accession | NZ_CP122844 | ||
Organism | Escherichia coli strain ETEC1722 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | S1EXB8 |
Locus tag | QDX00_RS18180 | Protein ID | WP_001263493.1 |
Coordinates | 3702616..3703014 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | S1FJN6 |
Locus tag | QDX00_RS18185 | Protein ID | WP_000554757.1 |
Coordinates | 3703017..3703310 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
- (3698276) | 3698276..3698356 | - | 81 | NuclAT_11 | - | - |
- (3698276) | 3698276..3698356 | - | 81 | NuclAT_11 | - | - |
- (3698276) | 3698276..3698356 | - | 81 | NuclAT_11 | - | - |
- (3698276) | 3698276..3698356 | - | 81 | NuclAT_11 | - | - |
QDX00_RS18150 (3697616) | 3697616..3698860 | - | 1245 | WP_000189541.1 | esterase FrsA | - |
QDX00_RS18155 (3698952) | 3698952..3699410 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
QDX00_RS18160 (3699671) | 3699671..3701128 | + | 1458 | WP_001293003.1 | cytosol nonspecific dipeptidase | - |
QDX00_RS18165 (3701185) | 3701185..3701706 | - | 522 | Protein_3556 | peptide chain release factor H | - |
QDX00_RS18170 (3701705) | 3701705..3701908 | - | 204 | Protein_3557 | RtcB family protein | - |
QDX00_RS18175 (3702154) | 3702154..3702606 | - | 453 | WP_001059847.1 | GNAT family N-acetyltransferase | - |
QDX00_RS18180 (3702616) | 3702616..3703014 | - | 399 | WP_001263493.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
QDX00_RS18185 (3703017) | 3703017..3703310 | - | 294 | WP_000554757.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
QDX00_RS18190 (3703362) | 3703362..3704417 | - | 1056 | WP_001226164.1 | DNA polymerase IV | - |
QDX00_RS18195 (3704488) | 3704488..3705273 | - | 786 | WP_000207564.1 | putative lateral flagellar export/assembly protein LafU | - |
QDX00_RS18200 (3705245) | 3705245..3706957 | + | 1713 | Protein_3563 | flagellar biosynthesis protein FlhA | - |
QDX00_RS18205 (3707181) | 3707181..3707678 | - | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15472.83 Da Isoelectric Point: 8.0949
>T278065 WP_001263493.1 NZ_CP122844:c3703014-3702616 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|