Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 94676..94940 | Replicon | plasmid unnamed6 |
| Accession | NZ_CP122843 | ||
| Organism | Escherichia coli strain ETEC1729 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | E6BRV3 |
| Locus tag | QDW97_RS27245 | Protein ID | WP_001303307.1 |
| Coordinates | 94676..94828 (-) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 94878..94940 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDW97_RS27220 (89878) | 89878..92046 | + | 2169 | WP_000698360.1 | IncI1-type conjugal transfer membrane protein TraY | - |
| QDW97_RS27225 (92122) | 92122..92736 | + | 615 | WP_000578649.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| QDW97_RS27230 (92834) | 92834..93043 | + | 210 | WP_001140545.1 | hemolysin expression modulator Hha | - |
| QDW97_RS27235 (93253) | 93253..93429 | + | 177 | WP_001054900.1 | hypothetical protein | - |
| - (93915) | 93915..93966 | + | 52 | NuclAT_1 | - | - |
| - (93915) | 93915..93966 | + | 52 | NuclAT_1 | - | - |
| - (93915) | 93915..93966 | + | 52 | NuclAT_1 | - | - |
| - (93915) | 93915..93966 | + | 52 | NuclAT_1 | - | - |
| QDW97_RS27240 (94353) | 94353..94604 | + | 252 | WP_001291965.1 | hypothetical protein | - |
| QDW97_RS27245 (94676) | 94676..94828 | - | 153 | WP_001303307.1 | Hok/Gef family protein | Toxin |
| - (94878) | 94878..94940 | + | 63 | NuclAT_0 | - | Antitoxin |
| - (94878) | 94878..94940 | + | 63 | NuclAT_0 | - | Antitoxin |
| - (94878) | 94878..94940 | + | 63 | NuclAT_0 | - | Antitoxin |
| - (94878) | 94878..94940 | + | 63 | NuclAT_0 | - | Antitoxin |
| QDW97_RS27250 (95120) | 95120..96328 | + | 1209 | WP_000121273.1 | IncI1-type conjugal transfer protein TrbA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..96346 | 96346 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5817.21 Da Isoelectric Point: 8.7948
>T278046 WP_001303307.1 NZ_CP122843:c94828-94676 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
Antitoxin
Download Length: 63 bp
>AT278046 NZ_CP122843:94878-94940 [Escherichia coli]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|