Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 94676..94940 Replicon plasmid unnamed6
Accession NZ_CP122843
Organism Escherichia coli strain ETEC1729

Toxin (Protein)


Gene name pndA Uniprot ID E6BRV3
Locus tag QDW97_RS27245 Protein ID WP_001303307.1
Coordinates 94676..94828 (-) Length 51 a.a.

Antitoxin (RNA)


Gene name pndB
Locus tag -
Coordinates 94878..94940 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDW97_RS27220 (89878) 89878..92046 + 2169 WP_000698360.1 IncI1-type conjugal transfer membrane protein TraY -
QDW97_RS27225 (92122) 92122..92736 + 615 WP_000578649.1 plasmid IncI1-type surface exclusion protein ExcA -
QDW97_RS27230 (92834) 92834..93043 + 210 WP_001140545.1 hemolysin expression modulator Hha -
QDW97_RS27235 (93253) 93253..93429 + 177 WP_001054900.1 hypothetical protein -
- (93915) 93915..93966 + 52 NuclAT_1 - -
- (93915) 93915..93966 + 52 NuclAT_1 - -
- (93915) 93915..93966 + 52 NuclAT_1 - -
- (93915) 93915..93966 + 52 NuclAT_1 - -
QDW97_RS27240 (94353) 94353..94604 + 252 WP_001291965.1 hypothetical protein -
QDW97_RS27245 (94676) 94676..94828 - 153 WP_001303307.1 Hok/Gef family protein Toxin
- (94878) 94878..94940 + 63 NuclAT_0 - Antitoxin
- (94878) 94878..94940 + 63 NuclAT_0 - Antitoxin
- (94878) 94878..94940 + 63 NuclAT_0 - Antitoxin
- (94878) 94878..94940 + 63 NuclAT_0 - Antitoxin
QDW97_RS27250 (95120) 95120..96328 + 1209 WP_000121273.1 IncI1-type conjugal transfer protein TrbA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..96346 96346


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(7-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5817.21 Da        Isoelectric Point: 8.7948

>T278046 WP_001303307.1 NZ_CP122843:c94828-94676 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR

Download         Length: 153 bp

Antitoxin


Download         Length: 63 bp

>AT278046 NZ_CP122843:94878-94940 [Escherichia coli]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A634Q5L1

Antitoxin

Download structure file

References