Detailed information of TA system TA278037

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 68326..68747
• Replicon: plasmid unnamed1
• Accession: NZ_CP122838
• Organism: Escherichia coli strain ETEC1729

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: QDW97_RS24690
• Protein ID: WP_096937776.1
• Coordinates: 68622..68747 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	srnC
Locus tag	-
Coordinates	68326..68524 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
QDW97_RS24650 (63539)	63539..63951	-	413	Protein_75	hypothetical protein	-
QDW97_RS24655 (64021)	64021..64227	+	207	WP_000275848.1	hypothetical protein	-
QDW97_RS24660 (64253)	64253..64792	+	540	WP_000290811.1	single-stranded DNA-binding protein	-
QDW97_RS24665 (64854)	64854..65087	+	234	WP_000005985.1	DUF905 family protein	-
QDW97_RS24670 (65151)	65151..67109	+	1959	WP_000117204.1	ParB/RepB/Spo0J family partition protein	-
QDW97_RS24675 (67164)	67164..67598	+	435	WP_000845912.1	conjugation system SOS inhibitor PsiB	-
QDW97_RS24680 (67595)	67595..68357	+	763	Protein_81	plasmid SOS inhibition protein A	-
- (68326)	68326..68524	+	199	NuclAT_0	-	Antitoxin
- (68326)	68326..68524	+	199	NuclAT_0	-	Antitoxin
- (68326)	68326..68524	+	199	NuclAT_0	-	Antitoxin
- (68326)	68326..68524	+	199	NuclAT_0	-	Antitoxin
QDW97_RS24685 (68531)	68531..68680	+	150	Protein_82	DUF5431 family protein	-
QDW97_RS24690 (68622)	68622..68747	+	126	WP_096937776.1	type I toxin-antitoxin system Hok family toxin	Toxin
QDW97_RS24695 (69048)	69048..69234	-	187	Protein_84	pilus protein	-
QDW97_RS24700 (69294)	69294..69581	+	288	WP_000107541.1	hypothetical protein	-
QDW97_RS24705 (69699)	69699..70520	+	822	WP_001424949.1	DUF932 domain-containing protein	-
QDW97_RS24710 (70816)	70816..71418	-	603	WP_077632063.1	transglycosylase SLT domain-containing protein	-
QDW97_RS24715 (71740)	71740..72123	+	384	WP_001151534.1	conjugal transfer relaxosome DNA-binding protein TraM	-
QDW97_RS24720 (72314)	72314..72961	+	648	WP_000332521.1	conjugal transfer transcriptional regulator TraJ	-
QDW97_RS24725 (73097)	73097..73312	+	216	WP_071782156.1	conjugal transfer relaxosome protein TraY	-
QDW97_RS24730 (73356)	73356..73721	+	366	WP_000338819.1	type IV conjugative transfer system pilin TraA	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	-	eltB / eltA	1..94250	94250

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4806.72 Da
• Isoelectric Point: 8.4890

>T278037 WP_096937776.1 NZ_CP122838:68622-68747 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGYREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 199 bp

>AT278037 NZ_CP122838:68326-68524 [Escherichia coli]
TCATACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGGATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAGGA
CAAAAGCCCCGTAGTTAATTTTTCATTAACCCACGAGGC

Structures

Antitoxin