Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4761950..4762552 | Replicon | chromosome |
Accession | NZ_CP122837 | ||
Organism | Escherichia coli strain ETEC1729 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | QDW97_RS23125 | Protein ID | WP_000897305.1 |
Coordinates | 4762241..4762552 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | QDW97_RS23120 | Protein ID | WP_000356397.1 |
Coordinates | 4761950..4762240 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDW97_RS23095 (4757876) | 4757876..4758778 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
QDW97_RS23100 (4758775) | 4758775..4759410 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
QDW97_RS23105 (4759407) | 4759407..4760336 | + | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
QDW97_RS23110 (4760666) | 4760666..4760908 | - | 243 | WP_001086388.1 | protein YiiF | - |
QDW97_RS23115 (4761127) | 4761127..4761345 | - | 219 | WP_001295676.1 | CopG family transcriptional regulator | - |
QDW97_RS23120 (4761950) | 4761950..4762240 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
QDW97_RS23125 (4762241) | 4762241..4762552 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
QDW97_RS23130 (4762781) | 4762781..4763689 | + | 909 | WP_282843660.1 | alpha/beta hydrolase | - |
QDW97_RS23135 (4763753) | 4763753..4764694 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
QDW97_RS23140 (4764739) | 4764739..4765176 | - | 438 | WP_094105341.1 | D-aminoacyl-tRNA deacylase | - |
QDW97_RS23145 (4765173) | 4765173..4766045 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
QDW97_RS23150 (4766039) | 4766039..4766638 | - | 600 | WP_001315111.1 | glucose-1-phosphatase | - |
QDW97_RS23155 (4766737) | 4766737..4767522 | - | 786 | WP_000059678.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T278035 WP_000897305.1 NZ_CP122837:c4762552-4762241 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|