Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 101366..101630 Replicon plasmid unnamed3
Accession NZ_CP122835
Organism Escherichia coli strain ETEC1730

Toxin (Protein)


Gene name pndA Uniprot ID E6BRV3
Locus tag QDY27_RS27190 Protein ID WP_001303307.1
Coordinates 101366..101518 (-) Length 51 a.a.

Antitoxin (RNA)


Gene name pndB
Locus tag -
Coordinates 101573..101630 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDY27_RS27160 (96644) 96644..98811 + 2168 Protein_108 DotA/TraY family protein -
QDY27_RS27165 (98885) 98885..99535 + 651 WP_001178506.1 plasmid IncI1-type surface exclusion protein ExcA -
QDY27_RS27170 (99607) 99607..99816 - 210 WP_000062603.1 HEAT repeat domain-containing protein -
QDY27_RS27175 (100208) 100208..100384 + 177 WP_001054900.1 hypothetical protein -
QDY27_RS27180 (100449) 100449..100544 - 96 WP_001303310.1 DinQ-like type I toxin DqlB -
QDY27_RS27185 (101043) 101043..101294 + 252 WP_001291965.1 hypothetical protein -
QDY27_RS27190 (101366) 101366..101518 - 153 WP_001303307.1 Hok/Gef family protein Toxin
- (101573) 101573..101630 + 58 NuclAT_0 - Antitoxin
- (101573) 101573..101630 + 58 NuclAT_0 - Antitoxin
- (101573) 101573..101630 + 58 NuclAT_0 - Antitoxin
- (101573) 101573..101630 + 58 NuclAT_0 - Antitoxin
QDY27_RS27195 (101810) 101810..103018 + 1209 WP_000121273.1 IncI1-type conjugal transfer protein TrbA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaTEM-1B / aph(3')-Ia - 1..104099 104099


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(7-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5817.21 Da        Isoelectric Point: 8.7948

>T278015 WP_001303307.1 NZ_CP122835:c101518-101366 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR

Download         Length: 153 bp

Antitoxin


Download         Length: 58 bp

>AT278015 NZ_CP122835:101573-101630 [Escherichia coli]
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A634Q5L1

Antitoxin

Download structure file

References