Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 101366..101630 | Replicon | plasmid unnamed3 |
| Accession | NZ_CP122835 | ||
| Organism | Escherichia coli strain ETEC1730 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | E6BRV3 |
| Locus tag | QDY27_RS27190 | Protein ID | WP_001303307.1 |
| Coordinates | 101366..101518 (-) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 101573..101630 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDY27_RS27160 (96644) | 96644..98811 | + | 2168 | Protein_108 | DotA/TraY family protein | - |
| QDY27_RS27165 (98885) | 98885..99535 | + | 651 | WP_001178506.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| QDY27_RS27170 (99607) | 99607..99816 | - | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
| QDY27_RS27175 (100208) | 100208..100384 | + | 177 | WP_001054900.1 | hypothetical protein | - |
| QDY27_RS27180 (100449) | 100449..100544 | - | 96 | WP_001303310.1 | DinQ-like type I toxin DqlB | - |
| QDY27_RS27185 (101043) | 101043..101294 | + | 252 | WP_001291965.1 | hypothetical protein | - |
| QDY27_RS27190 (101366) | 101366..101518 | - | 153 | WP_001303307.1 | Hok/Gef family protein | Toxin |
| - (101573) | 101573..101630 | + | 58 | NuclAT_0 | - | Antitoxin |
| - (101573) | 101573..101630 | + | 58 | NuclAT_0 | - | Antitoxin |
| - (101573) | 101573..101630 | + | 58 | NuclAT_0 | - | Antitoxin |
| - (101573) | 101573..101630 | + | 58 | NuclAT_0 | - | Antitoxin |
| QDY27_RS27195 (101810) | 101810..103018 | + | 1209 | WP_000121273.1 | IncI1-type conjugal transfer protein TrbA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaTEM-1B / aph(3')-Ia | - | 1..104099 | 104099 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5817.21 Da Isoelectric Point: 8.7948
>T278015 WP_001303307.1 NZ_CP122835:c101518-101366 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
Antitoxin
Download Length: 58 bp
>AT278015 NZ_CP122835:101573-101630 [Escherichia coli]
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|