Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 22970..23224 | Replicon | plasmid unnamed2 |
| Accession | NZ_CP122834 | ||
| Organism | Escherichia coli strain ETEC1730 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | QDY27_RS25870 | Protein ID | WP_001312851.1 |
| Coordinates | 23075..23224 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 22970..23031 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDY27_RS25840 (18357) | 18357..19523 | - | 1167 | Protein_23 | IS66 family transposase | - |
| QDY27_RS25845 (19543) | 19543..19890 | - | 348 | WP_213833996.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| QDY27_RS25850 (19890) | 19890..20024 | - | 135 | Protein_25 | IS66 family insertion sequence element accessory protein TnpB | - |
| QDY27_RS25855 (20213) | 20213..21400 | - | 1188 | WP_000937614.1 | IS91-like element IS91 family transposase | - |
| QDY27_RS25860 (21400) | 21400..21765 | - | 366 | WP_000124098.1 | hypothetical protein | - |
| QDY27_RS25865 (21866) | 21866..22369 | - | 504 | Protein_28 | IS66-like element accessory protein TnpA | - |
| - (22970) | 22970..23031 | - | 62 | NuclAT_0 | - | Antitoxin |
| - (22970) | 22970..23031 | - | 62 | NuclAT_0 | - | Antitoxin |
| - (22970) | 22970..23031 | - | 62 | NuclAT_0 | - | Antitoxin |
| - (22970) | 22970..23031 | - | 62 | NuclAT_0 | - | Antitoxin |
| QDY27_RS25870 (23075) | 23075..23224 | + | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| QDY27_RS25875 (23508) | 23508..23765 | + | 258 | WP_000083845.1 | replication regulatory protein RepA | - |
| QDY27_RS25880 (23999) | 23999..24073 | + | 75 | WP_001442103.1 | RepA leader peptide Tap | - |
| QDY27_RS25885 (24066) | 24066..24548 | + | 483 | WP_001523473.1 | hypothetical protein | - |
| QDY27_RS25890 (24541) | 24541..25398 | + | 858 | WP_032084499.1 | incFII family plasmid replication initiator RepA | - |
| QDY27_RS25895 (26311) | 26311..26595 | + | 285 | WP_032084498.1 | ribbon-helix-helix protein, CopG family | - |
| QDY27_RS25900 (26595) | 26595..26780 | + | 186 | Protein_35 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| QDY27_RS25905 (26854) | 26854..27636 | - | 783 | WP_001317493.1 | IS21-like element IS100kyp family helper ATPase IstB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | hlyD / hlyC / hlyA / hlyB / hlyD | 1..165083 | 165083 | |
| - | inside | IScluster/Tn | - | - | 15354..38819 | 23465 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T278008 WP_001312851.1 NZ_CP122834:23075-23224 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT278008 NZ_CP122834:c23031-22970 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
