Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 72939..73208 | Replicon | plasmid unnamed6 |
| Accession | NZ_CP122829 | ||
| Organism | Escherichia coli strain ETEC1732 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | QDX01_RS28025 | Protein ID | WP_096937776.1 |
| Coordinates | 73083..73208 (+) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 72939..73004 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDX01_RS27990 (69080) | 69080..69514 | + | 435 | WP_000845915.1 | conjugation system SOS inhibitor PsiB | - |
| QDX01_RS27995 (69511) | 69511..70267 | + | 757 | Protein_71 | plasmid SOS inhibition protein A | - |
| QDX01_RS28000 (70349) | 70349..70774 | + | 426 | WP_000422741.1 | transposase | - |
| QDX01_RS28005 (70771) | 70771..71121 | + | 351 | WP_000624722.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| QDX01_RS28010 (71152) | 71152..72765 | + | 1614 | WP_282835484.1 | IS66-like element ISEc23 family transposase | - |
| QDX01_RS28015 (72752) | 72752..72970 | - | 219 | WP_282835486.1 | hypothetical protein | - |
| - (72939) | 72939..73004 | + | 66 | NuclAT_1 | - | - |
| - (72939) | 72939..73004 | - | 66 | NuclAT_0 | - | Antitoxin |
| - (72792) | 72792..73006 | + | 215 | NuclAT_0 | - | - |
| - (72792) | 72792..73006 | + | 215 | NuclAT_0 | - | - |
| - (72792) | 72792..73006 | + | 215 | NuclAT_0 | - | - |
| - (72792) | 72792..73006 | + | 215 | NuclAT_0 | - | - |
| - (72795) | 72795..73006 | - | 212 | NuclAT_0 | - | - |
| QDX01_RS28020 (72992) | 72992..73141 | + | 150 | Protein_76 | plasmid maintenance protein Mok | - |
| QDX01_RS28025 (73083) | 73083..73208 | + | 126 | WP_096937776.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| QDX01_RS28030 (73553) | 73553..75124 | - | 1572 | WP_000381443.1 | IS66 family transposase | - |
| QDX01_RS28035 (75144) | 75144..75491 | - | 348 | WP_000624618.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| QDX01_RS28040 (75491) | 75491..76141 | - | 651 | WP_000993956.1 | IS66-like element accessory protein TnpA | - |
| QDX01_RS28045 (76227) | 76227..76488 | - | 262 | Protein_81 | hypothetical protein | - |
| QDX01_RS28050 (76555) | 76555..76731 | + | 177 | Protein_82 | DUF932 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4806.72 Da Isoelectric Point: 8.4890
>T277987 WP_096937776.1 NZ_CP122829:73083-73208 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGYREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGYREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 66 bp
>AT277987 NZ_CP122829:c73004-72939 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
