Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
Location | 28002..28713 | Replicon | plasmid unnamed5 |
Accession | NZ_CP122828 | ||
Organism | Escherichia coli strain ETEC1732 |
Toxin (Protein)
Gene name | higB | Uniprot ID | I2UJZ0 |
Locus tag | QDX01_RS27295 | Protein ID | WP_000162415.1 |
Coordinates | 28411..28713 (-) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | QDX01_RS27290 | Protein ID | WP_000806445.1 |
Coordinates | 28002..28340 (-) | Length | 113 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDX01_RS27255 (QDX01_27255) | 23159..23551 | - | 393 | WP_000824758.1 | hypothetical protein | - |
QDX01_RS27260 (QDX01_27260) | 23572..24180 | - | 609 | WP_282835468.1 | hypothetical protein | - |
QDX01_RS27265 (QDX01_27265) | 24464..25117 | + | 654 | WP_000410952.1 | hypothetical protein | - |
QDX01_RS27270 (QDX01_27270) | 25446..25775 | + | 330 | WP_000542383.1 | hypothetical protein | - |
QDX01_RS27275 (QDX01_27275) | 25768..26961 | + | 1194 | WP_001112633.1 | hypothetical protein | - |
QDX01_RS27280 (QDX01_27280) | 26995..27723 | - | 729 | WP_000986754.1 | hypothetical protein | - |
QDX01_RS27285 (QDX01_27285) | 27760..27945 | - | 186 | Protein_46 | hypothetical protein | - |
QDX01_RS27290 (QDX01_27290) | 28002..28340 | - | 339 | WP_000806445.1 | HigA family addiction module antitoxin | Antitoxin |
QDX01_RS27295 (QDX01_27295) | 28411..28713 | - | 303 | WP_000162415.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QDX01_RS27300 (QDX01_27300) | 28876..29667 | + | 792 | WP_000532305.1 | hypothetical protein | - |
QDX01_RS27305 (QDX01_27305) | 29664..30431 | + | 768 | WP_000203290.1 | hypothetical protein | - |
QDX01_RS27310 (QDX01_27310) | 30435..31415 | + | 981 | WP_000046499.1 | hypothetical protein | - |
QDX01_RS27315 (QDX01_27315) | 31460..32065 | + | 606 | WP_223699645.1 | carbohydrate-binding domain-containing protein | - |
QDX01_RS27320 (QDX01_27320) | 32125..33030 | + | 906 | WP_282835469.1 | recombination-associated protein RdgC | - |
QDX01_RS27325 (QDX01_27325) | 33074..33694 | + | 621 | WP_044862276.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..90359 | 90359 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11818.56 Da Isoelectric Point: 9.8739
>T277985 WP_000162415.1 NZ_CP122828:c28713-28411 [Escherichia coli]
MTKKINIKDFRDAWLDDFFEFSTPHRKIPPDIHMTLSRKLDIINAATTCKDLRSPPGNRYEELSGKLNGYSSVRVNKQYR
LIFKWVNGKAEDLYLDPHKY
MTKKINIKDFRDAWLDDFFEFSTPHRKIPPDIHMTLSRKLDIINAATTCKDLRSPPGNRYEELSGKLNGYSSVRVNKQYR
LIFKWVNGKAEDLYLDPHKY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|