Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 4144827..4145521 Replicon chromosome
Accession NZ_CP122823
Organism Escherichia coli strain ETEC1732

Toxin (Protein)


Gene name yafO Uniprot ID S1EXB8
Locus tag QDX01_RS21020 Protein ID WP_001263493.1
Coordinates 4144827..4145225 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID S1FJN6
Locus tag QDX01_RS21025 Protein ID WP_000554757.1
Coordinates 4145228..4145521 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
- (4140494) 4140494..4140574 - 81 NuclAT_11 - -
- (4140494) 4140494..4140574 - 81 NuclAT_11 - -
- (4140494) 4140494..4140574 - 81 NuclAT_11 - -
- (4140494) 4140494..4140574 - 81 NuclAT_11 - -
QDX01_RS20990 (4139834) 4139834..4141078 - 1245 WP_000189541.1 esterase FrsA -
QDX01_RS20995 (4141170) 4141170..4141628 - 459 WP_001291990.1 xanthine phosphoribosyltransferase -
QDX01_RS21000 (4141889) 4141889..4143346 + 1458 WP_001293003.1 cytosol nonspecific dipeptidase -
QDX01_RS21005 (4143403) 4143403..4143917 - 515 Protein_4113 peptide chain release factor H -
QDX01_RS21010 (4143916) 4143916..4144119 - 204 Protein_4114 RtcB family protein -
QDX01_RS21015 (4144365) 4144365..4144817 - 453 WP_001059847.1 GNAT family N-acetyltransferase -
QDX01_RS21020 (4144827) 4144827..4145225 - 399 WP_001263493.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
QDX01_RS21025 (4145228) 4145228..4145521 - 294 WP_000554757.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
QDX01_RS21030 (4145573) 4145573..4146628 - 1056 WP_001226164.1 DNA polymerase IV -
QDX01_RS21035 (4146699) 4146699..4147484 - 786 WP_000207587.1 putative lateral flagellar export/assembly protein LafU -
QDX01_RS21040 (4147456) 4147456..4149168 + 1713 Protein_4120 flagellar biosynthesis protein FlhA -
QDX01_RS21045 (4149392) 4149392..4149889 - 498 Protein_4121 REP-associated tyrosine transposase RayT -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - gmhA/lpcA 4143865..4160107 16242


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15472.83 Da        Isoelectric Point: 8.0949

>T277973 WP_001263493.1 NZ_CP122823:c4145225-4144827 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11233.81 Da        Isoelectric Point: 5.9050

>AT277973 WP_000554757.1 NZ_CP122823:c4145521-4145228 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKPIKARFRPSAARLEEITRRA
EKYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1EXB8

Antitoxin

Source ID Structure
AlphaFold DB S1FJN6

References