Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 4144827..4145521 | Replicon | chromosome |
| Accession | NZ_CP122823 | ||
| Organism | Escherichia coli strain ETEC1732 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | S1EXB8 |
| Locus tag | QDX01_RS21020 | Protein ID | WP_001263493.1 |
| Coordinates | 4144827..4145225 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | S1FJN6 |
| Locus tag | QDX01_RS21025 | Protein ID | WP_000554757.1 |
| Coordinates | 4145228..4145521 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| - (4140494) | 4140494..4140574 | - | 81 | NuclAT_11 | - | - |
| - (4140494) | 4140494..4140574 | - | 81 | NuclAT_11 | - | - |
| - (4140494) | 4140494..4140574 | - | 81 | NuclAT_11 | - | - |
| - (4140494) | 4140494..4140574 | - | 81 | NuclAT_11 | - | - |
| QDX01_RS20990 (4139834) | 4139834..4141078 | - | 1245 | WP_000189541.1 | esterase FrsA | - |
| QDX01_RS20995 (4141170) | 4141170..4141628 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
| QDX01_RS21000 (4141889) | 4141889..4143346 | + | 1458 | WP_001293003.1 | cytosol nonspecific dipeptidase | - |
| QDX01_RS21005 (4143403) | 4143403..4143917 | - | 515 | Protein_4113 | peptide chain release factor H | - |
| QDX01_RS21010 (4143916) | 4143916..4144119 | - | 204 | Protein_4114 | RtcB family protein | - |
| QDX01_RS21015 (4144365) | 4144365..4144817 | - | 453 | WP_001059847.1 | GNAT family N-acetyltransferase | - |
| QDX01_RS21020 (4144827) | 4144827..4145225 | - | 399 | WP_001263493.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| QDX01_RS21025 (4145228) | 4145228..4145521 | - | 294 | WP_000554757.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| QDX01_RS21030 (4145573) | 4145573..4146628 | - | 1056 | WP_001226164.1 | DNA polymerase IV | - |
| QDX01_RS21035 (4146699) | 4146699..4147484 | - | 786 | WP_000207587.1 | putative lateral flagellar export/assembly protein LafU | - |
| QDX01_RS21040 (4147456) | 4147456..4149168 | + | 1713 | Protein_4120 | flagellar biosynthesis protein FlhA | - |
| QDX01_RS21045 (4149392) | 4149392..4149889 | - | 498 | Protein_4121 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | gmhA/lpcA | 4143865..4160107 | 16242 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15472.83 Da Isoelectric Point: 8.0949
>T277973 WP_001263493.1 NZ_CP122823:c4145225-4144827 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|