Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2730989..2731627 | Replicon | chromosome |
Accession | NZ_CP122823 | ||
Organism | Escherichia coli strain ETEC1732 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | QDX01_RS13620 | Protein ID | WP_000813794.1 |
Coordinates | 2731451..2731627 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | QDX01_RS13615 | Protein ID | WP_001270286.1 |
Coordinates | 2730989..2731405 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDX01_RS13595 (2726141) | 2726141..2727082 | - | 942 | WP_001251304.1 | ABC transporter permease | - |
QDX01_RS13600 (2727083) | 2727083..2728096 | - | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
QDX01_RS13605 (2728114) | 2728114..2729259 | - | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
QDX01_RS13610 (2729504) | 2729504..2730910 | - | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
QDX01_RS13615 (2730989) | 2730989..2731405 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
QDX01_RS13620 (2731451) | 2731451..2731627 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
QDX01_RS13625 (2731849) | 2731849..2732079 | + | 231 | WP_000494244.1 | YncJ family protein | - |
QDX01_RS13630 (2732171) | 2732171..2734132 | - | 1962 | WP_001303492.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
QDX01_RS13635 (2734205) | 2734205..2734741 | - | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
QDX01_RS13640 (2734833) | 2734833..2736005 | + | 1173 | WP_001236264.1 | BenE family transporter YdcO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 2736048..2737196 | 1148 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T277970 WP_000813794.1 NZ_CP122823:c2731627-2731451 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT277970 WP_001270286.1 NZ_CP122823:c2731405-2730989 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|