Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 761726..762419 | Replicon | chromosome |
Accession | NZ_CP122823 | ||
Organism | Escherichia coli strain ETEC1732 |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | S1EZG2 |
Locus tag | QDX01_RS03705 | Protein ID | WP_000415584.1 |
Coordinates | 761726..762022 (+) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | S1EBV2 |
Locus tag | QDX01_RS03710 | Protein ID | WP_000650107.1 |
Coordinates | 762024..762419 (+) | Length | 132 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDX01_RS03670 (756813) | 756813..757127 | - | 315 | WP_000958598.1 | putative quinol monooxygenase | - |
QDX01_RS03675 (757158) | 757158..757740 | - | 583 | Protein_720 | NADPH:quinone oxidoreductase MdaB | - |
QDX01_RS03680 (758059) | 758059..758391 | + | 333 | WP_000917684.1 | DUF2645 family protein | - |
QDX01_RS03685 (758437) | 758437..759786 | - | 1350 | WP_000673402.1 | quorum sensing histidine kinase QseC | - |
QDX01_RS03690 (759783) | 759783..760442 | - | 660 | WP_001221493.1 | quorum sensing response regulator transcription factor QseB | - |
QDX01_RS03695 (760594) | 760594..760986 | + | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
QDX01_RS03700 (761039) | 761039..761521 | + | 483 | WP_000183505.1 | GyrI-like domain-containing protein | - |
QDX01_RS03705 (761726) | 761726..762022 | + | 297 | WP_000415584.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
QDX01_RS03710 (762024) | 762024..762419 | + | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
QDX01_RS03715 (762552) | 762552..764159 | + | 1608 | WP_001295629.1 | ABC transporter substrate-binding protein | - |
QDX01_RS03720 (764297) | 764297..766555 | + | 2259 | WP_159135099.1 | DNA topoisomerase IV subunit A | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11231.96 Da Isoelectric Point: 8.9070
>T277962 WP_000415584.1 NZ_CP122823:761726-762022 [Escherichia coli]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT277962 WP_000650107.1 NZ_CP122823:762024-762419 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|