Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 1161..1425 Replicon plasmid unnamed3
Accession NZ_CP122819
Organism Escherichia coli strain ETEC1731

Toxin (Protein)


Gene name pndA Uniprot ID E6BRV3
Locus tag QDY29_RS25410 Protein ID WP_001303307.1
Coordinates 1161..1313 (-) Length 51 a.a.

Antitoxin (RNA)


Gene name pndB
Locus tag -
Coordinates 1363..1425 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDY29_RS25395 (1) 1..177 + 177 WP_001054904.1 hypothetical protein -
QDY29_RS25400 (242) 242..337 - 96 WP_000609148.1 DinQ-like type I toxin DqlB -
QDY29_RS25405 (838) 838..1089 + 252 WP_001291965.1 hypothetical protein -
QDY29_RS25410 (1161) 1161..1313 - 153 WP_001303307.1 Hok/Gef family protein Toxin
- (1363) 1363..1425 + 63 NuclAT_0 - Antitoxin
- (1363) 1363..1425 + 63 NuclAT_0 - Antitoxin
- (1363) 1363..1425 + 63 NuclAT_0 - Antitoxin
- (1363) 1363..1425 + 63 NuclAT_0 - Antitoxin
QDY29_RS25415 (1940) 1940..2719 + 780 WP_275450201.1 protein FinQ -
- (2786) 2786..2846 + 61 NuclAT_1 - -
- (2786) 2786..2846 + 61 NuclAT_1 - -
- (2786) 2786..2846 + 61 NuclAT_1 - -
- (2786) 2786..2846 + 61 NuclAT_1 - -
QDY29_RS25420 (3026) 3026..4234 + 1209 WP_000121273.1 IncI1-type conjugal transfer protein TrbA -
QDY29_RS25425 (4253) 4253..5323 + 1071 WP_000151582.1 IncI1-type conjugal transfer protein TrbB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..91117 91117


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(7-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5817.21 Da        Isoelectric Point: 8.7948

>T277952 WP_001303307.1 NZ_CP122819:c1313-1161 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR

Download         Length: 153 bp

Antitoxin


Download         Length: 63 bp

>AT277952 NZ_CP122819:1363-1425 [Escherichia coli]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A634Q5L1

Antitoxin

Download structure file

References