Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-ohsC/Ldr(toxin) |
Location | 4369384..4369605 | Replicon | chromosome |
Accession | NC_017906 | ||
Organism | Escherichia coli Xuzhou21 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | S1NWX0 |
Locus tag | CDCO157_RS31605 | Protein ID | WP_001295224.1 |
Coordinates | 4369384..4369491 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | ohsC | ||
Locus tag | - | ||
Coordinates | 4369540..4369605 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CDCO157_RS22540 | 4364637..4365389 | - | 753 | Protein_4251 | cellulose biosynthesis protein BcsQ | - |
CDCO157_RS22550 | 4365401..4365589 | - | 189 | WP_001063316.1 | YhjR family protein | - |
CDCO157_RS22555 | 4365862..4367433 | + | 1572 | WP_001204920.1 | cellulose biosynthesis protein BcsE | - |
CDCO157_RS22560 | 4367430..4367621 | + | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
CDCO157_RS22565 | 4367618..4369297 | + | 1680 | WP_000191596.1 | cellulose biosynthesis protein BcsG | - |
CDCO157_RS31605 | 4369384..4369491 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
- | 4369540..4369605 | + | 66 | NuclAT_15 | - | Antitoxin |
- | 4369540..4369605 | + | 66 | NuclAT_15 | - | Antitoxin |
- | 4369540..4369605 | + | 66 | NuclAT_15 | - | Antitoxin |
- | 4369540..4369605 | + | 66 | NuclAT_15 | - | Antitoxin |
- | 4369540..4369605 | + | 66 | NuclAT_20 | - | Antitoxin |
- | 4369540..4369605 | + | 66 | NuclAT_20 | - | Antitoxin |
- | 4369540..4369605 | + | 66 | NuclAT_20 | - | Antitoxin |
- | 4369540..4369605 | + | 66 | NuclAT_20 | - | Antitoxin |
CDCO157_RS22580 | 4369967..4371238 | + | 1272 | WP_001301684.1 | amino acid permease | - |
CDCO157_RS22585 | 4371268..4372272 | - | 1005 | WP_000107027.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
CDCO157_RS22590 | 4372269..4373252 | - | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
CDCO157_RS22595 | 4373263..4374165 | - | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T27795 WP_001295224.1 NC_017906:c4369491-4369384 [Escherichia coli Xuzhou21]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T27795 NC_017906:c4369491-4369384 [Escherichia coli Xuzhou21]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 66 bp
>AT27795 NC_017906:4369540-4369605 [Escherichia coli Xuzhou21]
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|