Detailed information of TA system TA277949

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 68267..68688
• Replicon: plasmid unnamed1
• Accession: NZ_CP122817
• Organism: Escherichia coli strain ETEC1731

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: QDY29_RS24675
• Protein ID: WP_096937776.1
• Coordinates: 68563..68688 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	srnC
Locus tag	-
Coordinates	68267..68465 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
QDY29_RS24635 (63466)	63466..63892	-	427	Protein_76	hypothetical protein	-
QDY29_RS24640 (63962)	63962..64168	+	207	WP_000275848.1	hypothetical protein	-
QDY29_RS24645 (64194)	64194..64733	+	540	WP_000290811.1	single-stranded DNA-binding protein	-
QDY29_RS24650 (64795)	64795..65028	+	234	WP_000005985.1	DUF905 family protein	-
QDY29_RS24655 (65092)	65092..67050	+	1959	WP_000117204.1	ParB/RepB/Spo0J family partition protein	-
QDY29_RS24660 (67105)	67105..67539	+	435	WP_000845912.1	conjugation system SOS inhibitor PsiB	-
QDY29_RS24665 (67536)	67536..68298	+	763	Protein_82	plasmid SOS inhibition protein A	-
- (68267)	68267..68465	+	199	NuclAT_0	-	Antitoxin
- (68267)	68267..68465	+	199	NuclAT_0	-	Antitoxin
- (68267)	68267..68465	+	199	NuclAT_0	-	Antitoxin
- (68267)	68267..68465	+	199	NuclAT_0	-	Antitoxin
QDY29_RS24670 (68472)	68472..68621	+	150	Protein_83	DUF5431 family protein	-
QDY29_RS24675 (68563)	68563..68688	+	126	WP_096937776.1	type I toxin-antitoxin system Hok family toxin	Toxin
QDY29_RS24680 (68989)	68989..69175	-	187	Protein_85	pilus protein	-
QDY29_RS24685 (69235)	69235..69522	+	288	WP_000107541.1	hypothetical protein	-
QDY29_RS24690 (69640)	69640..70461	+	822	WP_001424949.1	DUF932 domain-containing protein	-
QDY29_RS24695 (70757)	70757..71359	-	603	WP_077632063.1	transglycosylase SLT domain-containing protein	-
QDY29_RS24700 (71682)	71682..72065	+	384	WP_001151534.1	conjugal transfer relaxosome DNA-binding protein TraM	-
QDY29_RS24705 (72256)	72256..72903	+	648	WP_000332521.1	conjugal transfer transcriptional regulator TraJ	-
QDY29_RS24710 (73039)	73039..73254	+	216	WP_071782156.1	conjugal transfer relaxosome protein TraY	-
QDY29_RS24715 (73298)	73298..73663	+	366	WP_000338819.1	type IV conjugative transfer system pilin TraA	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	-	eltB / eltA	1..91480	91480

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4806.72 Da
• Isoelectric Point: 8.4890

>T277949 WP_096937776.1 NZ_CP122817:68563-68688 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGYREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 199 bp

>AT277949 NZ_CP122817:68267-68465 [Escherichia coli]
TCATACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGGATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAGGA
CAAAAGCCCCGTAGTTAATTTTTCATTAACCCACGAGGC

Structures

Antitoxin