Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 734522..735215 | Replicon | chromosome |
Accession | NZ_CP122816 | ||
Organism | Escherichia coli strain ETEC1731 |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | S1EZG2 |
Locus tag | QDY29_RS03615 | Protein ID | WP_000415584.1 |
Coordinates | 734522..734818 (+) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | S1EBV2 |
Locus tag | QDY29_RS03620 | Protein ID | WP_000650107.1 |
Coordinates | 734820..735215 (+) | Length | 132 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDY29_RS03585 (730197) | 730197..730511 | - | 315 | WP_000958598.1 | putative quinol monooxygenase | - |
QDY29_RS03590 (730542) | 730542..731123 | - | 582 | WP_000065430.1 | NADPH:quinone oxidoreductase MdaB | - |
QDY29_RS03595 (731233) | 731233..732582 | - | 1350 | WP_000673406.1 | quorum sensing histidine kinase QseC | - |
QDY29_RS03600 (732579) | 732579..733238 | - | 660 | WP_001221491.1 | quorum sensing response regulator transcription factor QseB | - |
QDY29_RS03605 (733390) | 733390..733782 | + | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
QDY29_RS03610 (733835) | 733835..734317 | + | 483 | WP_000183498.1 | GyrI-like domain-containing protein | - |
QDY29_RS03615 (734522) | 734522..734818 | + | 297 | WP_000415584.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
QDY29_RS03620 (734820) | 734820..735215 | + | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
QDY29_RS03625 (735348) | 735348..736955 | + | 1608 | WP_001324265.1 | ABC transporter substrate-binding protein | - |
QDY29_RS03630 (737093) | 737093..739351 | + | 2259 | WP_001281881.1 | DNA topoisomerase IV subunit A | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 722532..735215 | 12683 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11231.96 Da Isoelectric Point: 8.9070
>T277929 WP_000415584.1 NZ_CP122816:734522-734818 [Escherichia coli]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT277929 WP_000650107.1 NZ_CP122816:734820-735215 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|