Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
Location | 70382..71093 | Replicon | plasmid unnamed8 |
Accession | NZ_CP122809 | ||
Organism | Escherichia coli strain ETEC1734 |
Toxin (Protein)
Gene name | higB | Uniprot ID | I2UJZ0 |
Locus tag | QDX84_RS28485 | Protein ID | WP_000162415.1 |
Coordinates | 70382..70684 (+) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | QDX84_RS28490 | Protein ID | WP_000806445.1 |
Coordinates | 70755..71093 (+) | Length | 113 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDX84_RS28455 (QDX84_28455) | 65401..66021 | - | 621 | WP_044862276.1 | hypothetical protein | - |
QDX84_RS28460 (QDX84_28460) | 66065..66970 | - | 906 | WP_282835469.1 | recombination-associated protein RdgC | - |
QDX84_RS28465 (QDX84_28465) | 67030..67635 | - | 606 | WP_223699645.1 | carbohydrate-binding domain-containing protein | - |
QDX84_RS28470 (QDX84_28470) | 67680..68660 | - | 981 | WP_000046499.1 | hypothetical protein | - |
QDX84_RS28475 (QDX84_28475) | 68664..69431 | - | 768 | WP_000203290.1 | hypothetical protein | - |
QDX84_RS28480 (QDX84_28480) | 69428..70219 | - | 792 | WP_000532305.1 | hypothetical protein | - |
QDX84_RS28485 (QDX84_28485) | 70382..70684 | + | 303 | WP_000162415.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QDX84_RS28490 (QDX84_28490) | 70755..71093 | + | 339 | WP_000806445.1 | HigA family addiction module antitoxin | Antitoxin |
QDX84_RS28495 (QDX84_28495) | 71150..71335 | + | 186 | Protein_77 | hypothetical protein | - |
QDX84_RS28500 (QDX84_28500) | 71372..72100 | + | 729 | WP_000986754.1 | hypothetical protein | - |
QDX84_RS28505 (QDX84_28505) | 72134..73327 | - | 1194 | WP_001112633.1 | hypothetical protein | - |
QDX84_RS28510 (QDX84_28510) | 73320..73649 | - | 330 | WP_000542383.1 | hypothetical protein | - |
QDX84_RS28515 (QDX84_28515) | 73978..74631 | - | 654 | WP_000410952.1 | hypothetical protein | - |
QDX84_RS28520 (QDX84_28520) | 74915..75523 | + | 609 | WP_282835468.1 | hypothetical protein | - |
QDX84_RS28525 (QDX84_28525) | 75544..75936 | + | 393 | WP_000824758.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..90361 | 90361 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11818.56 Da Isoelectric Point: 9.8739
>T277925 WP_000162415.1 NZ_CP122809:70382-70684 [Escherichia coli]
MTKKINIKDFRDAWLDDFFEFSTPHRKIPPDIHMTLSRKLDIINAATTCKDLRSPPGNRYEELSGKLNGYSSVRVNKQYR
LIFKWVNGKAEDLYLDPHKY
MTKKINIKDFRDAWLDDFFEFSTPHRKIPPDIHMTLSRKLDIINAATTCKDLRSPPGNRYEELSGKLNGYSSVRVNKQYR
LIFKWVNGKAEDLYLDPHKY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|