Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 69747..70016 Replicon plasmid unnamed4
Accession NZ_CP122805
Organism Escherichia coli strain ETEC1734

Toxin (Protein)


Gene name hok Uniprot ID -
Locus tag QDX84_RS27380 Protein ID WP_096937776.1
Coordinates 69891..70016 (+) Length 42 a.a.

Antitoxin (RNA)


Gene name sok
Locus tag -
Coordinates 69747..69812 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDX84_RS27345 (65888) 65888..66322 + 435 WP_000845915.1 conjugation system SOS inhibitor PsiB -
QDX84_RS27350 (66319) 66319..67075 + 757 Protein_68 plasmid SOS inhibition protein A -
QDX84_RS27355 (67157) 67157..67582 + 426 WP_000422741.1 transposase -
QDX84_RS27360 (67579) 67579..67929 + 351 WP_000624722.1 IS66 family insertion sequence element accessory protein TnpB -
QDX84_RS27365 (67960) 67960..69573 + 1614 WP_282835484.1 IS66-like element ISEc23 family transposase -
QDX84_RS27370 (69560) 69560..69778 - 219 WP_282835486.1 hypothetical protein -
- (69747) 69747..69812 + 66 NuclAT_1 - -
- (69747) 69747..69812 - 66 NuclAT_0 - Antitoxin
- (69600) 69600..69814 + 215 NuclAT_0 - -
- (69600) 69600..69814 + 215 NuclAT_0 - -
- (69600) 69600..69814 + 215 NuclAT_0 - -
- (69600) 69600..69814 + 215 NuclAT_0 - -
- (69603) 69603..69814 - 212 NuclAT_0 - -
QDX84_RS27375 (69800) 69800..69949 + 150 Protein_73 plasmid maintenance protein Mok -
QDX84_RS27380 (69891) 69891..70016 + 126 WP_096937776.1 type I toxin-antitoxin system Hok family toxin Toxin
QDX84_RS27385 (70361) 70361..71932 - 1572 WP_000381443.1 IS66 family transposase -
QDX84_RS27390 (71952) 71952..72299 - 348 WP_000624618.1 IS66 family insertion sequence element accessory protein TnpB -
QDX84_RS27395 (72299) 72299..72949 - 651 WP_000993956.1 IS66-like element accessory protein TnpA -
QDX84_RS27400 (73035) 73035..73296 - 262 Protein_78 hypothetical protein -
QDX84_RS27405 (73363) 73363..73539 + 177 Protein_79 DUF932 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(2-37)


Sequences

Toxin        


Download         Length: 42 a.a.        Molecular weight: 4806.72 Da        Isoelectric Point: 8.4890

>T277918 WP_096937776.1 NZ_CP122805:69891-70016 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGYREVAAFMAYESGK

Download         Length: 126 bp

Antitoxin


Download         Length: 66 bp

>AT277918 NZ_CP122805:c69812-69747 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References