Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 69603..70016 | Replicon | plasmid unnamed4 |
Accession | NZ_CP122805 | ||
Organism | Escherichia coli strain ETEC1734 |
Toxin (Protein)
Gene name | hok | Uniprot ID | - |
Locus tag | QDX84_RS27380 | Protein ID | WP_096937776.1 |
Coordinates | 69891..70016 (+) | Length | 42 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 69603..69814 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDX84_RS27345 (65888) | 65888..66322 | + | 435 | WP_000845915.1 | conjugation system SOS inhibitor PsiB | - |
QDX84_RS27350 (66319) | 66319..67075 | + | 757 | Protein_68 | plasmid SOS inhibition protein A | - |
QDX84_RS27355 (67157) | 67157..67582 | + | 426 | WP_000422741.1 | transposase | - |
QDX84_RS27360 (67579) | 67579..67929 | + | 351 | WP_000624722.1 | IS66 family insertion sequence element accessory protein TnpB | - |
QDX84_RS27365 (67960) | 67960..69573 | + | 1614 | WP_282835484.1 | IS66-like element ISEc23 family transposase | - |
QDX84_RS27370 (69560) | 69560..69778 | - | 219 | WP_282835486.1 | hypothetical protein | - |
- (69747) | 69747..69812 | + | 66 | NuclAT_1 | - | - |
- (69747) | 69747..69812 | - | 66 | NuclAT_0 | - | - |
- (69600) | 69600..69814 | + | 215 | NuclAT_0 | - | - |
- (69600) | 69600..69814 | + | 215 | NuclAT_0 | - | - |
- (69600) | 69600..69814 | + | 215 | NuclAT_0 | - | - |
- (69600) | 69600..69814 | + | 215 | NuclAT_0 | - | - |
- (69603) | 69603..69814 | - | 212 | NuclAT_0 | - | Antitoxin |
QDX84_RS27375 (69800) | 69800..69949 | + | 150 | Protein_73 | plasmid maintenance protein Mok | - |
QDX84_RS27380 (69891) | 69891..70016 | + | 126 | WP_096937776.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
QDX84_RS27385 (70361) | 70361..71932 | - | 1572 | WP_000381443.1 | IS66 family transposase | - |
QDX84_RS27390 (71952) | 71952..72299 | - | 348 | WP_000624618.1 | IS66 family insertion sequence element accessory protein TnpB | - |
QDX84_RS27395 (72299) | 72299..72949 | - | 651 | WP_000993956.1 | IS66-like element accessory protein TnpA | - |
QDX84_RS27400 (73035) | 73035..73296 | - | 262 | Protein_78 | hypothetical protein | - |
QDX84_RS27405 (73363) | 73363..73539 | + | 177 | Protein_79 | DUF932 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4806.72 Da Isoelectric Point: 8.4890
>T277917 WP_096937776.1 NZ_CP122805:69891-70016 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGYREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGYREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 212 bp
>AT277917 NZ_CP122805:c69814-69603 [Escherichia coli]
ATGTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTTTCTGCCACACA
ACACGGCAACAAACCACCTTCACGTCATGAGGCAGAAAGCCTCAAGCGCCGGGCACATCATAGCCCATATACCTGCACGC
TGACCACACTCACTTTCCCTGAAAATAATCTGGTCGTTCAGCCAGTTCACGG
ATGTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTTTCTGCCACACA
ACACGGCAACAAACCACCTTCACGTCATGAGGCAGAAAGCCTCAAGCGCCGGGCACATCATAGCCCATATACCTGCACGC
TGACCACACTCACTTTCCCTGAAAATAATCTGGTCGTTCAGCCAGTTCACGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|