Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 34655..34919 | Replicon | plasmid unnamed3 |
| Accession | NZ_CP122804 | ||
| Organism | Escherichia coli strain ETEC1734 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | U9Y6M3 |
| Locus tag | QDX84_RS26720 | Protein ID | WP_001331364.1 |
| Coordinates | 34767..34919 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 34655..34712 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDX84_RS26705 (29895) | 29895..32185 | - | 2291 | Protein_40 | F-type conjugative transfer protein TrbC | - |
| QDX84_RS26710 (32178) | 32178..33248 | - | 1071 | WP_000151583.1 | IncI1-type conjugal transfer protein TrbB | - |
| QDX84_RS26715 (33267) | 33267..34475 | - | 1209 | WP_000121273.1 | IncI1-type conjugal transfer protein TrbA | - |
| - (34655) | 34655..34712 | - | 58 | NuclAT_0 | - | Antitoxin |
| - (34655) | 34655..34712 | - | 58 | NuclAT_0 | - | Antitoxin |
| - (34655) | 34655..34712 | - | 58 | NuclAT_0 | - | Antitoxin |
| - (34655) | 34655..34712 | - | 58 | NuclAT_0 | - | Antitoxin |
| QDX84_RS26720 (34767) | 34767..34919 | + | 153 | WP_001331364.1 | Hok/Gef family protein | Toxin |
| QDX84_RS26725 (34991) | 34991..35242 | - | 252 | WP_001291964.1 | hypothetical protein | - |
| QDX84_RS26730 (35328) | 35328..36899 | - | 1572 | WP_000381443.1 | IS66 family transposase | - |
| QDX84_RS26735 (36919) | 36919..37266 | - | 348 | WP_000624618.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| QDX84_RS26740 (37266) | 37266..37916 | - | 651 | WP_000993956.1 | IS66-like element accessory protein TnpA | - |
| QDX84_RS26745 (38254) | 38254..38787 | - | 534 | WP_001372168.1 | transcription termination/antitermination NusG family protein | - |
| QDX84_RS26750 (39229) | 39229..39516 | - | 288 | WP_000074849.1 | conjugal transfer protein TraA | - |
| QDX84_RS26755 (39434) | 39434..39664 | - | 231 | WP_228772074.1 | ash family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | aadA5 / sul2 | - | 1..79114 | 79114 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5775.13 Da Isoelectric Point: 8.7948
>T277910 WP_001331364.1 NZ_CP122804:34767-34919 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
Antitoxin
Download Length: 58 bp
>AT277910 NZ_CP122804:c34712-34655 [Escherichia coli]
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
