Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 4144810..4145504 Replicon chromosome
Accession NZ_CP122801
Organism Escherichia coli strain ETEC1734

Toxin (Protein)


Gene name yafO Uniprot ID S1EXB8
Locus tag QDX84_RS21015 Protein ID WP_001263493.1
Coordinates 4144810..4145208 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID S1FJN6
Locus tag QDX84_RS21020 Protein ID WP_000554757.1
Coordinates 4145211..4145504 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
- (4140478) 4140478..4140558 - 81 NuclAT_11 - -
- (4140478) 4140478..4140558 - 81 NuclAT_11 - -
- (4140478) 4140478..4140558 - 81 NuclAT_11 - -
- (4140478) 4140478..4140558 - 81 NuclAT_11 - -
QDX84_RS20985 (4139818) 4139818..4141062 - 1245 WP_000189541.1 esterase FrsA -
QDX84_RS20990 (4141154) 4141154..4141612 - 459 WP_001291990.1 xanthine phosphoribosyltransferase -
QDX84_RS20995 (4141873) 4141873..4143330 + 1458 WP_001293003.1 cytosol nonspecific dipeptidase -
QDX84_RS21000 (4143387) 4143387..4143901 - 515 Protein_4112 peptide chain release factor H -
QDX84_RS21005 (4143900) 4143900..4144103 - 204 Protein_4113 RtcB family protein -
QDX84_RS21010 (4144348) 4144348..4144800 - 453 WP_001059847.1 GNAT family N-acetyltransferase -
QDX84_RS21015 (4144810) 4144810..4145208 - 399 WP_001263493.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
QDX84_RS21020 (4145211) 4145211..4145504 - 294 WP_000554757.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
QDX84_RS21025 (4145556) 4145556..4146611 - 1056 WP_001226164.1 DNA polymerase IV -
QDX84_RS21030 (4146682) 4146682..4147467 - 786 WP_000207587.1 putative lateral flagellar export/assembly protein LafU -
QDX84_RS21035 (4147439) 4147439..4149151 + 1713 Protein_4119 flagellar biosynthesis protein FlhA -
QDX84_RS21040 (4149375) 4149375..4149872 - 498 Protein_4120 REP-associated tyrosine transposase RayT -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - gmhA/lpcA 4143849..4160089 16240


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15472.83 Da        Isoelectric Point: 8.0949

>T277906 WP_001263493.1 NZ_CP122801:c4145208-4144810 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11233.81 Da        Isoelectric Point: 5.9050

>AT277906 WP_000554757.1 NZ_CP122801:c4145504-4145211 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKPIKARFRPSAARLEEITRRA
EKYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1EXB8

Antitoxin

Source ID Structure
AlphaFold DB S1FJN6

References