Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
| Location | 761723..762416 | Replicon | chromosome |
| Accession | NZ_CP122801 | ||
| Organism | Escherichia coli strain ETEC1734 | ||
Toxin (Protein)
| Gene name | mqsR | Uniprot ID | S1EZG2 |
| Locus tag | QDX84_RS03705 | Protein ID | WP_000415584.1 |
| Coordinates | 761723..762019 (+) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | mqsA | Uniprot ID | S1EBV2 |
| Locus tag | QDX84_RS03710 | Protein ID | WP_000650107.1 |
| Coordinates | 762021..762416 (+) | Length | 132 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDX84_RS03670 (756810) | 756810..757124 | - | 315 | WP_000958598.1 | putative quinol monooxygenase | - |
| QDX84_RS03675 (757155) | 757155..757737 | - | 583 | Protein_720 | NADPH:quinone oxidoreductase MdaB | - |
| QDX84_RS03680 (758056) | 758056..758388 | + | 333 | WP_000917684.1 | DUF2645 family protein | - |
| QDX84_RS03685 (758434) | 758434..759783 | - | 1350 | WP_000673402.1 | quorum sensing histidine kinase QseC | - |
| QDX84_RS03690 (759780) | 759780..760439 | - | 660 | WP_001221493.1 | quorum sensing response regulator transcription factor QseB | - |
| QDX84_RS03695 (760591) | 760591..760983 | + | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
| QDX84_RS03700 (761036) | 761036..761518 | + | 483 | WP_000183505.1 | GyrI-like domain-containing protein | - |
| QDX84_RS03705 (761723) | 761723..762019 | + | 297 | WP_000415584.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
| QDX84_RS03710 (762021) | 762021..762416 | + | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
| QDX84_RS03715 (762549) | 762549..764157 | + | 1609 | Protein_728 | ABC transporter substrate-binding protein | - |
| QDX84_RS03720 (764295) | 764295..766553 | + | 2259 | WP_159135099.1 | DNA topoisomerase IV subunit A | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11231.96 Da Isoelectric Point: 8.9070
>T277895 WP_000415584.1 NZ_CP122801:761723-762019 [Escherichia coli]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT277895 WP_000650107.1 NZ_CP122801:762021-762416 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|