Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 56414..56683 | Replicon | plasmid unnamed3 |
| Accession | NZ_CP122771 | ||
| Organism | Escherichia coli strain ETEC1738 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | QDY55_RS29790 | Protein ID | WP_001372321.1 |
| Coordinates | 56558..56683 (+) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 56414..56479 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDY55_RS29755 (52383) | 52383..52817 | + | 435 | WP_042634413.1 | conjugation system SOS inhibitor PsiB | - |
| QDY55_RS29760 (52814) | 52814..53533 | + | 720 | WP_023181057.1 | plasmid SOS inhibition protein A | - |
| QDY55_RS29765 (53567) | 53567..55138 | - | 1572 | WP_000381442.1 | IS66 family transposase | - |
| QDY55_RS29770 (55158) | 55158..55505 | - | 348 | WP_000624618.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| QDY55_RS29775 (55505) | 55505..56155 | - | 651 | WP_000993956.1 | IS66-like element accessory protein TnpA | - |
| QDY55_RS29780 (56257) | 56257..56445 | - | 189 | WP_032084246.1 | hypothetical protein | - |
| - (56414) | 56414..56479 | + | 66 | NuclAT_1 | - | - |
| - (56414) | 56414..56479 | - | 66 | NuclAT_0 | - | Antitoxin |
| - (56257) | 56257..56481 | + | 225 | NuclAT_0 | - | - |
| - (56257) | 56257..56481 | + | 225 | NuclAT_0 | - | - |
| - (56257) | 56257..56481 | + | 225 | NuclAT_0 | - | - |
| - (56257) | 56257..56481 | + | 225 | NuclAT_0 | - | - |
| - (56257) | 56257..56481 | - | 225 | NuclAT_0 | - | - |
| QDY55_RS29785 (56467) | 56467..56616 | + | 150 | Protein_70 | plasmid maintenance protein Mok | - |
| QDY55_RS29790 (56558) | 56558..56683 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| QDY55_RS29795 (57078) | 57078..58745 | - | 1668 | WP_052991863.1 | group II intron reverse transcriptase/maturase | - |
| QDY55_RS29800 (59474) | 59474..59647 | - | 174 | Protein_73 | hypothetical protein | - |
| QDY55_RS29805 (59717) | 59717..59923 | + | 207 | WP_000547968.1 | hypothetical protein | - |
| QDY55_RS29810 (59948) | 59948..60235 | + | 288 | WP_000107535.1 | hypothetical protein | - |
| QDY55_RS29815 (60353) | 60353..61174 | + | 822 | WP_001234469.1 | DUF932 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T277890 WP_001372321.1 NZ_CP122771:56558-56683 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 66 bp
>AT277890 NZ_CP122771:c56479-56414 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
