Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 93004..93268 | Replicon | plasmid unnamed2 |
| Accession | NZ_CP122770 | ||
| Organism | Escherichia coli strain ETEC1738 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | E6BRV3 |
| Locus tag | QDY55_RS29430 | Protein ID | WP_001303307.1 |
| Coordinates | 93004..93156 (-) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 93206..93268 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDY55_RS29405 (88007) | 88007..90175 | + | 2169 | WP_000698368.1 | DotA/TraY family protein | - |
| QDY55_RS29410 (90246) | 90246..90908 | + | 663 | WP_000644794.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| QDY55_RS29415 (90980) | 90980..91189 | - | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
| QDY55_RS29420 (91581) | 91581..91757 | + | 177 | WP_001054900.1 | hypothetical protein | - |
| - (92243) | 92243..92294 | + | 52 | NuclAT_1 | - | - |
| - (92243) | 92243..92294 | + | 52 | NuclAT_1 | - | - |
| - (92243) | 92243..92294 | + | 52 | NuclAT_1 | - | - |
| - (92243) | 92243..92294 | + | 52 | NuclAT_1 | - | - |
| QDY55_RS29425 (92681) | 92681..92932 | + | 252 | WP_001291965.1 | hypothetical protein | - |
| QDY55_RS29430 (93004) | 93004..93156 | - | 153 | WP_001303307.1 | Hok/Gef family protein | Toxin |
| - (93206) | 93206..93268 | + | 63 | NuclAT_0 | - | Antitoxin |
| - (93206) | 93206..93268 | + | 63 | NuclAT_0 | - | Antitoxin |
| - (93206) | 93206..93268 | + | 63 | NuclAT_0 | - | Antitoxin |
| - (93206) | 93206..93268 | + | 63 | NuclAT_0 | - | Antitoxin |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..93447 | 93447 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5817.21 Da Isoelectric Point: 8.7948
>T277885 WP_001303307.1 NZ_CP122770:c93156-93004 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
Antitoxin
Download Length: 63 bp
>AT277885 NZ_CP122770:93206-93268 [Escherichia coli]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|