Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | symE-orzP/SymE(toxin) |
Location | 4854917..4855329 | Replicon | chromosome |
Accession | NZ_CP122768 | ||
Organism | Escherichia coli strain ETEC1738 |
Toxin (Protein)
Gene name | symE | Uniprot ID | - |
Locus tag | QDY55_RS24365 | Protein ID | WP_064225814.1 |
Coordinates | 4854988..4855329 (+) | Length | 114 a.a. |
Antitoxin (RNA)
Gene name | orzP | ||
Locus tag | - | ||
Coordinates | 4854917..4854993 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDY55_RS24350 (4851806) | 4851806..4853395 | + | 1590 | WP_064225816.1 | type I restriction-modification system methyltransferase | - |
QDY55_RS24355 (4853392) | 4853392..4854072 | + | 681 | WP_187771894.1 | restriction endonuclease subunit S | - |
QDY55_RS24360 (4854399) | 4854399..4854760 | + | 362 | Protein_4777 | restriction endonuclease subunit S | - |
- (4854917) | 4854917..4854993 | - | 77 | NuclAT_11 | - | Antitoxin |
- (4854917) | 4854917..4854993 | - | 77 | NuclAT_11 | - | Antitoxin |
- (4854917) | 4854917..4854993 | - | 77 | NuclAT_11 | - | Antitoxin |
- (4854917) | 4854917..4854993 | - | 77 | NuclAT_11 | - | Antitoxin |
- (4854917) | 4854917..4854993 | - | 77 | NuclAT_12 | - | Antitoxin |
- (4854917) | 4854917..4854993 | - | 77 | NuclAT_12 | - | Antitoxin |
- (4854917) | 4854917..4854993 | - | 77 | NuclAT_12 | - | Antitoxin |
- (4854917) | 4854917..4854993 | - | 77 | NuclAT_12 | - | Antitoxin |
QDY55_RS24365 (4854988) | 4854988..4855329 | + | 342 | WP_064225814.1 | endoribonuclease SymE | Toxin |
QDY55_RS24370 (4855491) | 4855491..4856870 | + | 1380 | WP_064225813.1 | 5-methylcytosine-specific restriction endonuclease subunit McrB | - |
QDY55_RS24375 (4856870) | 4856870..4857916 | + | 1047 | WP_074397940.1 | 5-methylcytosine-specific restriction endonuclease system specificity protein McrC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | espX6 | 4854012..4878639 | 24627 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12275.12 Da Isoelectric Point: 8.4888
>T277878 WP_064225814.1 NZ_CP122768:4854988-4855329 [Escherichia coli]
MTDTNFIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAEESE
LMQSLRQVCKLSARKQKQVQAFIGVIAGKQKVA
MTDTNFIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAEESE
LMQSLRQVCKLSARKQKQVQAFIGVIAGKQKVA
Download Length: 342 bp
Antitoxin
Download Length: 77 bp
>AT277878 NZ_CP122768:c4854993-4854917 [Escherichia coli]
AGTCATAACTGCTATTCTCCTGGAATAGTGATTGTGATGAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATAACTGCTATTCTCCTGGAATAGTGATTGTGATGAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|