Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 4438215..4438909 | Replicon | chromosome |
| Accession | NZ_CP122768 | ||
| Organism | Escherichia coli strain ETEC1738 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | A0A0D8WHS4 |
| Locus tag | QDY55_RS22335 | Protein ID | WP_001521903.1 |
| Coordinates | 4438215..4438613 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | L4JHF0 |
| Locus tag | QDY55_RS22340 | Protein ID | WP_000554755.1 |
| Coordinates | 4438616..4438909 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| - (4434045) | 4434045..4434125 | - | 81 | NuclAT_8 | - | - |
| - (4434045) | 4434045..4434125 | - | 81 | NuclAT_8 | - | - |
| - (4434045) | 4434045..4434125 | - | 81 | NuclAT_8 | - | - |
| - (4434045) | 4434045..4434125 | - | 81 | NuclAT_8 | - | - |
| QDY55_RS22305 (4433385) | 4433385..4434629 | - | 1245 | WP_000189541.1 | esterase FrsA | - |
| QDY55_RS22310 (4434721) | 4434721..4435179 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
| QDY55_RS22315 (4435440) | 4435440..4436897 | + | 1458 | WP_034173578.1 | cytosol nonspecific dipeptidase | - |
| QDY55_RS22320 (4436954) | 4436954..4437306 | - | 353 | Protein_4380 | peptide chain release factor H | - |
| QDY55_RS22325 (4437302) | 4437302..4437508 | - | 207 | Protein_4381 | RtcB family protein | - |
| QDY55_RS22330 (4437753) | 4437753..4438205 | - | 453 | WP_059342012.1 | GNAT family N-acetyltransferase | - |
| QDY55_RS22335 (4438215) | 4438215..4438613 | - | 399 | WP_001521903.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| QDY55_RS22340 (4438616) | 4438616..4438909 | - | 294 | WP_000554755.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| QDY55_RS22345 (4438961) | 4438961..4440016 | - | 1056 | WP_001226166.1 | DNA polymerase IV | - |
| QDY55_RS22350 (4440087) | 4440087..4441010 | - | 924 | WP_074397912.1 | putative lateral flagellar export/assembly protein LafU | - |
| QDY55_RS22355 (4441013) | 4441013..4441876 | - | 864 | WP_063081517.1 | flagellar motor stator protein MotA | - |
| QDY55_RS22360 (4441889) | 4441889..4442605 | - | 717 | WP_064225708.1 | FliA/WhiG family RNA polymerase sigma factor | - |
| QDY55_RS22365 (4442625) | 4442625..4443092 | - | 468 | WP_064225709.1 | flagellar basal body-associated FliL family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4418523..4438909 | 20386 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15471.88 Da Isoelectric Point: 8.0949
>T277877 WP_001521903.1 NZ_CP122768:c4438613-4438215 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGILPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGILPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0D8WHS4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829G9H5 |