Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 4438215..4438909 Replicon chromosome
Accession NZ_CP122768
Organism Escherichia coli strain ETEC1738

Toxin (Protein)


Gene name yafO Uniprot ID A0A0D8WHS4
Locus tag QDY55_RS22335 Protein ID WP_001521903.1
Coordinates 4438215..4438613 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID L4JHF0
Locus tag QDY55_RS22340 Protein ID WP_000554755.1
Coordinates 4438616..4438909 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
- (4434045) 4434045..4434125 - 81 NuclAT_8 - -
- (4434045) 4434045..4434125 - 81 NuclAT_8 - -
- (4434045) 4434045..4434125 - 81 NuclAT_8 - -
- (4434045) 4434045..4434125 - 81 NuclAT_8 - -
QDY55_RS22305 (4433385) 4433385..4434629 - 1245 WP_000189541.1 esterase FrsA -
QDY55_RS22310 (4434721) 4434721..4435179 - 459 WP_001291990.1 xanthine phosphoribosyltransferase -
QDY55_RS22315 (4435440) 4435440..4436897 + 1458 WP_034173578.1 cytosol nonspecific dipeptidase -
QDY55_RS22320 (4436954) 4436954..4437306 - 353 Protein_4380 peptide chain release factor H -
QDY55_RS22325 (4437302) 4437302..4437508 - 207 Protein_4381 RtcB family protein -
QDY55_RS22330 (4437753) 4437753..4438205 - 453 WP_059342012.1 GNAT family N-acetyltransferase -
QDY55_RS22335 (4438215) 4438215..4438613 - 399 WP_001521903.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
QDY55_RS22340 (4438616) 4438616..4438909 - 294 WP_000554755.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
QDY55_RS22345 (4438961) 4438961..4440016 - 1056 WP_001226166.1 DNA polymerase IV -
QDY55_RS22350 (4440087) 4440087..4441010 - 924 WP_074397912.1 putative lateral flagellar export/assembly protein LafU -
QDY55_RS22355 (4441013) 4441013..4441876 - 864 WP_063081517.1 flagellar motor stator protein MotA -
QDY55_RS22360 (4441889) 4441889..4442605 - 717 WP_064225708.1 FliA/WhiG family RNA polymerase sigma factor -
QDY55_RS22365 (4442625) 4442625..4443092 - 468 WP_064225709.1 flagellar basal body-associated FliL family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 4418523..4438909 20386


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15471.88 Da        Isoelectric Point: 8.0949

>T277877 WP_001521903.1 NZ_CP122768:c4438613-4438215 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGILPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11235.78 Da        Isoelectric Point: 5.2170

>AT277877 WP_000554755.1 NZ_CP122768:c4438909-4438616 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKLVKARFRPSAARLEEITRRA
EQYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0D8WHS4

Antitoxin

Source ID Structure
AlphaFold DB A0A829G9H5

References