Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 3885..4149 Replicon plasmid unnamed8
Accession NZ_CP122766
Organism Escherichia coli strain ETEC1739

Toxin (Protein)


Gene name pndA Uniprot ID E6BRV3
Locus tag QDW95_RS25475 Protein ID WP_001303307.1
Coordinates 3885..4037 (-) Length 51 a.a.

Antitoxin (RNA)


Gene name pndB
Locus tag -
Coordinates 4087..4149 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDW95_RS25455 (1127) 1127..1789 + 663 WP_000644794.1 plasmid IncI1-type surface exclusion protein ExcA -
QDW95_RS25460 (1861) 1861..2070 - 210 WP_000062603.1 HEAT repeat domain-containing protein -
QDW95_RS25465 (2462) 2462..2638 + 177 WP_001054900.1 hypothetical protein -
- (3124) 3124..3175 + 52 NuclAT_1 - -
- (3124) 3124..3175 + 52 NuclAT_1 - -
- (3124) 3124..3175 + 52 NuclAT_1 - -
- (3124) 3124..3175 + 52 NuclAT_1 - -
QDW95_RS25470 (3562) 3562..3813 + 252 WP_001291965.1 hypothetical protein -
QDW95_RS25475 (3885) 3885..4037 - 153 WP_001303307.1 Hok/Gef family protein Toxin
- (4087) 4087..4149 + 63 NuclAT_0 - Antitoxin
- (4087) 4087..4149 + 63 NuclAT_0 - Antitoxin
- (4087) 4087..4149 + 63 NuclAT_0 - Antitoxin
- (4087) 4087..4149 + 63 NuclAT_0 - Antitoxin
QDW95_RS25480 (4329) 4329..5537 + 1209 WP_000121273.1 IncI1-type conjugal transfer protein TrbA -
QDW95_RS25485 (5556) 5556..6626 + 1071 WP_000151583.1 IncI1-type conjugal transfer protein TrbB -
QDW95_RS25490 (6619) 6619..8910 + 2292 WP_001289276.1 F-type conjugative transfer protein TrbC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid aph(6)-Id / aph(3'')-Ib - 1..88929 88929


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(7-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5817.21 Da        Isoelectric Point: 8.7948

>T277853 WP_001303307.1 NZ_CP122766:c4037-3885 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR

Download         Length: 153 bp

Antitoxin


Download         Length: 63 bp

>AT277853 NZ_CP122766:4087-4149 [Escherichia coli]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A634Q5L1

Antitoxin

Download structure file

References