Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 3885..4149 | Replicon | plasmid unnamed8 |
| Accession | NZ_CP122766 | ||
| Organism | Escherichia coli strain ETEC1739 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | E6BRV3 |
| Locus tag | QDW95_RS25475 | Protein ID | WP_001303307.1 |
| Coordinates | 3885..4037 (-) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 4087..4149 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDW95_RS25455 (1127) | 1127..1789 | + | 663 | WP_000644794.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| QDW95_RS25460 (1861) | 1861..2070 | - | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
| QDW95_RS25465 (2462) | 2462..2638 | + | 177 | WP_001054900.1 | hypothetical protein | - |
| - (3124) | 3124..3175 | + | 52 | NuclAT_1 | - | - |
| - (3124) | 3124..3175 | + | 52 | NuclAT_1 | - | - |
| - (3124) | 3124..3175 | + | 52 | NuclAT_1 | - | - |
| - (3124) | 3124..3175 | + | 52 | NuclAT_1 | - | - |
| QDW95_RS25470 (3562) | 3562..3813 | + | 252 | WP_001291965.1 | hypothetical protein | - |
| QDW95_RS25475 (3885) | 3885..4037 | - | 153 | WP_001303307.1 | Hok/Gef family protein | Toxin |
| - (4087) | 4087..4149 | + | 63 | NuclAT_0 | - | Antitoxin |
| - (4087) | 4087..4149 | + | 63 | NuclAT_0 | - | Antitoxin |
| - (4087) | 4087..4149 | + | 63 | NuclAT_0 | - | Antitoxin |
| - (4087) | 4087..4149 | + | 63 | NuclAT_0 | - | Antitoxin |
| QDW95_RS25480 (4329) | 4329..5537 | + | 1209 | WP_000121273.1 | IncI1-type conjugal transfer protein TrbA | - |
| QDW95_RS25485 (5556) | 5556..6626 | + | 1071 | WP_000151583.1 | IncI1-type conjugal transfer protein TrbB | - |
| QDW95_RS25490 (6619) | 6619..8910 | + | 2292 | WP_001289276.1 | F-type conjugative transfer protein TrbC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | aph(6)-Id / aph(3'')-Ib | - | 1..88929 | 88929 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5817.21 Da Isoelectric Point: 8.7948
>T277853 WP_001303307.1 NZ_CP122766:c4037-3885 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
Antitoxin
Download Length: 63 bp
>AT277853 NZ_CP122766:4087-4149 [Escherichia coli]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|