Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 3773839..3774533 | Replicon | chromosome |
| Accession | NZ_CP122758 | ||
| Organism | Escherichia coli strain ETEC1739 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | S1EXB8 |
| Locus tag | QDW95_RS18655 | Protein ID | WP_001263493.1 |
| Coordinates | 3773839..3774237 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | S1FJN6 |
| Locus tag | QDW95_RS18660 | Protein ID | WP_000554757.1 |
| Coordinates | 3774240..3774533 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| - (3769499) | 3769499..3769579 | - | 81 | NuclAT_11 | - | - |
| - (3769499) | 3769499..3769579 | - | 81 | NuclAT_11 | - | - |
| - (3769499) | 3769499..3769579 | - | 81 | NuclAT_11 | - | - |
| - (3769499) | 3769499..3769579 | - | 81 | NuclAT_11 | - | - |
| QDW95_RS18625 (3768839) | 3768839..3770083 | - | 1245 | WP_000189541.1 | esterase FrsA | - |
| QDW95_RS18630 (3770175) | 3770175..3770633 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
| QDW95_RS18635 (3770894) | 3770894..3772351 | + | 1458 | WP_001293003.1 | cytosol nonspecific dipeptidase | - |
| QDW95_RS18640 (3772408) | 3772408..3772929 | - | 522 | Protein_3651 | peptide chain release factor H | - |
| QDW95_RS18645 (3772928) | 3772928..3773131 | - | 204 | Protein_3652 | RtcB family protein | - |
| QDW95_RS18650 (3773377) | 3773377..3773829 | - | 453 | WP_001059847.1 | GNAT family N-acetyltransferase | - |
| QDW95_RS18655 (3773839) | 3773839..3774237 | - | 399 | WP_001263493.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| QDW95_RS18660 (3774240) | 3774240..3774533 | - | 294 | WP_000554757.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| QDW95_RS18665 (3774585) | 3774585..3775641 | - | 1057 | Protein_3656 | DNA polymerase IV | - |
| QDW95_RS18670 (3775712) | 3775712..3776497 | - | 786 | WP_000207564.1 | putative lateral flagellar export/assembly protein LafU | - |
| QDW95_RS18675 (3776469) | 3776469..3778181 | + | 1713 | Protein_3658 | flagellar biosynthesis protein FlhA | - |
| QDW95_RS18680 (3778405) | 3778405..3778902 | - | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15472.83 Da Isoelectric Point: 8.0949
>T277845 WP_001263493.1 NZ_CP122758:c3774237-3773839 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|