Detailed information of TA system TA277828

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 2791..3060
• Replicon: plasmid unnamed5
• Accession: NZ_CP122732
• Organism: Escherichia coli strain ETEC1746

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: QDW99_RS24200
• Protein ID: WP_001372321.1
• Coordinates: 2935..3060 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	2791..2856 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
QDW99_RS24175	1..651	+	651	WP_000993956.1	IS66-like element accessory protein TnpA	-
QDW99_RS24180	651..998	+	348	WP_000624618.1	IS66 family insertion sequence element accessory protein TnpB	-
QDW99_RS24185	1018..2589	+	1572	WP_236495860.1	IS66 family transposase	-
QDW99_RS24190	2634..2822	-	189	WP_032084246.1	hypothetical protein	-
-	2634..2858	+	225	NuclAT_0	-	-
-	2634..2858	+	225	NuclAT_0	-	-
-	2634..2858	+	225	NuclAT_0	-	-
-	2634..2858	+	225	NuclAT_0	-	-
-	2791..2856	-	66	-	-	Antitoxin
QDW99_RS24195	2844..2993	+	150	Protein_4	plasmid maintenance protein Mok	-
QDW99_RS24200	2935..3060	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
QDW99_RS24205	3280..3510	+	231	WP_074014914.1	hypothetical protein	-
QDW99_RS24210	3508..3681	-	174	Protein_7	hypothetical protein	-
QDW99_RS24215	3751..4011	+	261	WP_042046747.1	hypothetical protein	-
QDW99_RS24220	4081..5109	-	1029	WP_169015401.1	IS110 family transposase	-
QDW99_RS24225	5360..5646	+	287	Protein_10	hypothetical protein	-
QDW99_RS24230	5765..6586	+	822	WP_074014913.1	DUF932 domain-containing protein	-
QDW99_RS24235	6883..7530	-	648	WP_123007297.1	transglycosylase SLT domain-containing protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	-	estIa	1..91044	91044

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T277828 WP_001372321.1 NZ_CP122732:2935-3060 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 66 bp

>AT277828 NZ_CP122732:c2856-2791 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Antitoxin