Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 3796578..3797272 Replicon chromosome
Accession NZ_CP122727
Organism Escherichia coli strain ETEC1746

Toxin (Protein)


Gene name yafO Uniprot ID S1EXB8
Locus tag QDW99_RS18750 Protein ID WP_001263493.1
Coordinates 3796578..3796976 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID S1FJN6
Locus tag QDW99_RS18755 Protein ID WP_000554757.1
Coordinates 3796979..3797272 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
- (3792238) 3792238..3792318 - 81 NuclAT_9 - -
- (3792238) 3792238..3792318 - 81 NuclAT_9 - -
- (3792238) 3792238..3792318 - 81 NuclAT_9 - -
- (3792238) 3792238..3792318 - 81 NuclAT_9 - -
QDW99_RS18720 (3791578) 3791578..3792822 - 1245 WP_000189541.1 esterase FrsA -
QDW99_RS18725 (3792914) 3792914..3793372 - 459 WP_001291990.1 xanthine phosphoribosyltransferase -
QDW99_RS18730 (3793633) 3793633..3795090 + 1458 WP_001293003.1 cytosol nonspecific dipeptidase -
QDW99_RS18735 (3795147) 3795147..3795668 - 522 Protein_3670 peptide chain release factor H -
QDW99_RS18740 (3795667) 3795667..3795870 - 204 Protein_3671 RtcB family protein -
QDW99_RS18745 (3796116) 3796116..3796568 - 453 WP_001059847.1 GNAT family N-acetyltransferase -
QDW99_RS18750 (3796578) 3796578..3796976 - 399 WP_001263493.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
QDW99_RS18755 (3796979) 3796979..3797272 - 294 WP_000554757.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
QDW99_RS18760 (3797324) 3797324..3798379 - 1056 WP_001226164.1 DNA polymerase IV -
QDW99_RS18765 (3798450) 3798450..3799373 - 924 WP_001232547.1 putative lateral flagellar export/assembly protein LafU -
QDW99_RS18770 (3799376) 3799376..3800239 - 864 WP_001169518.1 flagellar motor stator protein MotA -
QDW99_RS18775 (3800252) 3800252..3800968 - 717 WP_000938723.1 FliA/WhiG family RNA polymerase sigma factor -
QDW99_RS18780 (3800988) 3800988..3801455 - 468 WP_000725257.1 flagellar basal body-associated FliL family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 3781143..3797272 16129


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15472.83 Da        Isoelectric Point: 8.0949

>T277824 WP_001263493.1 NZ_CP122727:c3796976-3796578 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11233.81 Da        Isoelectric Point: 5.9050

>AT277824 WP_000554757.1 NZ_CP122727:c3797272-3796979 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKPIKARFRPSAARLEEITRRA
EKYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1EXB8

Antitoxin

Source ID Structure
AlphaFold DB S1FJN6

References