Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 3796578..3797272 | Replicon | chromosome |
| Accession | NZ_CP122727 | ||
| Organism | Escherichia coli strain ETEC1746 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | S1EXB8 |
| Locus tag | QDW99_RS18750 | Protein ID | WP_001263493.1 |
| Coordinates | 3796578..3796976 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | S1FJN6 |
| Locus tag | QDW99_RS18755 | Protein ID | WP_000554757.1 |
| Coordinates | 3796979..3797272 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| - (3792238) | 3792238..3792318 | - | 81 | NuclAT_9 | - | - |
| - (3792238) | 3792238..3792318 | - | 81 | NuclAT_9 | - | - |
| - (3792238) | 3792238..3792318 | - | 81 | NuclAT_9 | - | - |
| - (3792238) | 3792238..3792318 | - | 81 | NuclAT_9 | - | - |
| QDW99_RS18720 (3791578) | 3791578..3792822 | - | 1245 | WP_000189541.1 | esterase FrsA | - |
| QDW99_RS18725 (3792914) | 3792914..3793372 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
| QDW99_RS18730 (3793633) | 3793633..3795090 | + | 1458 | WP_001293003.1 | cytosol nonspecific dipeptidase | - |
| QDW99_RS18735 (3795147) | 3795147..3795668 | - | 522 | Protein_3670 | peptide chain release factor H | - |
| QDW99_RS18740 (3795667) | 3795667..3795870 | - | 204 | Protein_3671 | RtcB family protein | - |
| QDW99_RS18745 (3796116) | 3796116..3796568 | - | 453 | WP_001059847.1 | GNAT family N-acetyltransferase | - |
| QDW99_RS18750 (3796578) | 3796578..3796976 | - | 399 | WP_001263493.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| QDW99_RS18755 (3796979) | 3796979..3797272 | - | 294 | WP_000554757.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| QDW99_RS18760 (3797324) | 3797324..3798379 | - | 1056 | WP_001226164.1 | DNA polymerase IV | - |
| QDW99_RS18765 (3798450) | 3798450..3799373 | - | 924 | WP_001232547.1 | putative lateral flagellar export/assembly protein LafU | - |
| QDW99_RS18770 (3799376) | 3799376..3800239 | - | 864 | WP_001169518.1 | flagellar motor stator protein MotA | - |
| QDW99_RS18775 (3800252) | 3800252..3800968 | - | 717 | WP_000938723.1 | FliA/WhiG family RNA polymerase sigma factor | - |
| QDW99_RS18780 (3800988) | 3800988..3801455 | - | 468 | WP_000725257.1 | flagellar basal body-associated FliL family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 3781143..3797272 | 16129 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15472.83 Da Isoelectric Point: 8.0949
>T277824 WP_001263493.1 NZ_CP122727:c3796976-3796578 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|