Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ralRA/- |
Location | 2550213..2550584 | Replicon | chromosome |
Accession | NZ_CP122727 | ||
Organism | Escherichia coli strain ETEC1746 |
Toxin (Protein)
Gene name | ralR | Uniprot ID | - |
Locus tag | QDW99_RS12510 | Protein ID | WP_032083637.1 |
Coordinates | 2550213..2550407 (+) | Length | 65 a.a. |
Antitoxin (RNA)
Gene name | ralA | ||
Locus tag | - | ||
Coordinates | 2550406..2550584 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDW99_RS12490 (2545315) | 2545315..2545491 | + | 177 | WP_000241145.1 | YdaE family protein | - |
QDW99_RS12495 (2545565) | 2545565..2545840 | + | 276 | WP_000632298.1 | hypothetical protein | - |
QDW99_RS12500 (2545942) | 2545942..2549085 | + | 3144 | WP_032083635.1 | exodeoxyribonuclease VIII | - |
QDW99_RS12505 (2549097) | 2549097..2550149 | + | 1053 | WP_032083636.1 | RecT family recombinase | - |
QDW99_RS12510 (2550213) | 2550213..2550407 | + | 195 | WP_032083637.1 | type I toxin-antitoxin system endodeoxyribonuclease toxin RalR | Toxin |
- (2550406) | 2550406..2550584 | - | 179 | NuclAT_8 | - | Antitoxin |
- (2550406) | 2550406..2550584 | - | 179 | NuclAT_8 | - | Antitoxin |
- (2550406) | 2550406..2550584 | - | 179 | NuclAT_8 | - | Antitoxin |
- (2550406) | 2550406..2550584 | - | 179 | NuclAT_8 | - | Antitoxin |
QDW99_RS12515 (2550400) | 2550400..2550588 | + | 189 | WP_001602382.1 | DUF1187 family protein | - |
QDW99_RS12520 (2550688) | 2550688..2550903 | + | 216 | WP_000079604.1 | excisionase XisR | - |
QDW99_RS12525 (2550905) | 2550905..2552140 | + | 1236 | WP_072014650.1 | site-specific integrase | - |
QDW99_RS12530 (2552192) | 2552192..2553127 | + | 936 | WP_001157377.1 | tRNA 2-thiocytidine(32) synthetase TtcA | - |
QDW99_RS12535 (2553256) | 2553256..2554629 | - | 1374 | WP_000123737.1 | ATP-dependent RNA helicase DbpA | - |
QDW99_RS12540 (2554659) | 2554659..2554832 | - | 174 | WP_001296046.1 | protein YnaL | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2510859..2559399 | 48540 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 65 a.a. Molecular weight: 7107.02 Da Isoelectric Point: 9.5240
>T277819 WP_032083637.1 NZ_CP122727:2550213-2550407 [Escherichia coli]
MRYEKVKPYPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
MRYEKVKPYPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
Download Length: 195 bp
Antitoxin
Download Length: 179 bp
>AT277819 NZ_CP122727:c2550584-2550406 [Escherichia coli]
GAAGATTGAAGTTTCTCGCAATTAAAATTTATAAGTTTTACTTTCTGCTCTCTGGAAACACCAGCTTCTTTTTTCCCTGA
GAGCATTTTTTCGCATTCCGATTTGGTTAACTTTGTTGTTGAGTACCTTGTCCAGCTGGTAGGAGAACCTCCTTCCTTTT
CAATAGTGGCGGTAATTTT
GAAGATTGAAGTTTCTCGCAATTAAAATTTATAAGTTTTACTTTCTGCTCTCTGGAAACACCAGCTTCTTTTTTCCCTGA
GAGCATTTTTTCGCATTCCGATTTGGTTAACTTTGTTGTTGAGTACCTTGTCCAGCTGGTAGGAGAACCTCCTTCCTTTT
CAATAGTGGCGGTAATTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|