Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 754450..755143 | Replicon | chromosome |
Accession | NZ_CP122727 | ||
Organism | Escherichia coli strain ETEC1746 |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | S1EZG2 |
Locus tag | QDW99_RS03685 | Protein ID | WP_000415584.1 |
Coordinates | 754450..754746 (+) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | S1EBV2 |
Locus tag | QDW99_RS03690 | Protein ID | WP_000650107.1 |
Coordinates | 754748..755143 (+) | Length | 132 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDW99_RS03650 (750006) | 750006..750170 | + | 165 | Protein_716 | DUF2645 domain-containing protein | - |
QDW99_RS03660 (750939) | 750939..751115 | + | 177 | Protein_718 | DUF2645 domain-containing protein | - |
QDW99_RS03665 (751161) | 751161..752510 | - | 1350 | WP_001618857.1 | quorum sensing histidine kinase QseC | - |
QDW99_RS03670 (752507) | 752507..753166 | - | 660 | WP_001221493.1 | quorum sensing response regulator transcription factor QseB | - |
QDW99_RS03675 (753318) | 753318..753710 | + | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
QDW99_RS03680 (753763) | 753763..754245 | + | 483 | WP_000183505.1 | GyrI-like domain-containing protein | - |
QDW99_RS03685 (754450) | 754450..754746 | + | 297 | WP_000415584.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
QDW99_RS03690 (754748) | 754748..755143 | + | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
QDW99_RS03695 (755276) | 755276..756883 | + | 1608 | WP_032083699.1 | ABC transporter substrate-binding protein | - |
QDW99_RS03700 (757021) | 757021..759279 | + | 2259 | WP_001618856.1 | DNA topoisomerase IV subunit A | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11231.96 Da Isoelectric Point: 8.9070
>T277810 WP_000415584.1 NZ_CP122727:754450-754746 [Escherichia coli]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT277810 WP_000650107.1 NZ_CP122727:754748-755143 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|