Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ralRA/- |
Location | 2340611..2340982 | Replicon | chromosome |
Accession | NZ_CP122722 | ||
Organism | Escherichia coli strain ETEC1747 |
Toxin (Protein)
Gene name | ralR | Uniprot ID | F4VC37 |
Locus tag | QDW91_RS11745 | Protein ID | WP_001317028.1 |
Coordinates | 2340788..2340982 (-) | Length | 65 a.a. |
Antitoxin (RNA)
Gene name | ralA | ||
Locus tag | - | ||
Coordinates | 2340611..2340789 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDW91_RS11715 (2336363) | 2336363..2336536 | + | 174 | WP_001296046.1 | protein YnaL | - |
QDW91_RS11720 (2336566) | 2336566..2337939 | + | 1374 | WP_000123745.1 | ATP-dependent RNA helicase DbpA | - |
QDW91_RS11725 (2338068) | 2338068..2339003 | - | 936 | WP_001774812.1 | tRNA 2-thiocytidine(32) synthetase TtcA | - |
QDW91_RS11730 (2339055) | 2339055..2340290 | - | 1236 | WP_000040837.1 | site-specific integrase | - |
QDW91_RS11735 (2340292) | 2340292..2340507 | - | 216 | WP_000079604.1 | excisionase XisR | - |
- (2340611) | 2340611..2340789 | + | 179 | NuclAT_0 | - | Antitoxin |
- (2340611) | 2340611..2340789 | + | 179 | NuclAT_0 | - | Antitoxin |
- (2340611) | 2340611..2340789 | + | 179 | NuclAT_0 | - | Antitoxin |
- (2340611) | 2340611..2340789 | + | 179 | NuclAT_0 | - | Antitoxin |
QDW91_RS11740 (2340607) | 2340607..2340795 | - | 189 | WP_001383994.1 | DUF1187 family protein | - |
QDW91_RS11745 (2340788) | 2340788..2340982 | - | 195 | WP_001317028.1 | type I toxin-antitoxin system endodeoxyribonuclease toxin RalR | Toxin |
QDW91_RS11750 (2341039) | 2341039..2341848 | - | 810 | WP_064226362.1 | recombination protein RecT | - |
QDW91_RS11755 (2341841) | 2341841..2344492 | - | 2652 | WP_236500240.1 | exodeoxyribonuclease VIII | - |
QDW91_RS11760 (2344594) | 2344594..2344869 | - | 276 | WP_064226360.1 | hypothetical protein | - |
QDW91_RS11765 (2344944) | 2344944..2345108 | - | 165 | WP_064226359.1 | YdaE family protein | - |
QDW91_RS11770 (2345074) | 2345074..2345310 | - | 237 | WP_001093898.1 | DUF1482 family protein | - |
QDW91_RS11775 (2345459) | 2345459..2345731 | - | 273 | WP_001156287.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2339055..2387564 | 48509 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 65 a.a. Molecular weight: 7018.89 Da Isoelectric Point: 8.9538
>T277787 WP_001317028.1 NZ_CP122722:c2340982-2340788 [Escherichia coli]
MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
Download Length: 195 bp
Antitoxin
Download Length: 179 bp
>AT277787 NZ_CP122722:2340611-2340789 [Escherichia coli]
GACGACTGAAGTTTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAACGCCAGCTTCTTTTTTACCTGA
GAGCATTTTTTCGCATTCTGATTTGGTTAATTTTGTTTTTGAGTACCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATAGTAGCGGTAATTTT
GACGACTGAAGTTTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAACGCCAGCTTCTTTTTTACCTGA
GAGCATTTTTTCGCATTCTGATTTGGTTAATTTTGTTTTTGAGTACCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATAGTAGCGGTAATTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|