Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 752843..753536 | Replicon | chromosome |
Accession | NZ_CP122722 | ||
Organism | Escherichia coli strain ETEC1747 |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | S1EZG2 |
Locus tag | QDW91_RS03705 | Protein ID | WP_000415584.1 |
Coordinates | 752843..753139 (+) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | S1EBV2 |
Locus tag | QDW91_RS03710 | Protein ID | WP_000650107.1 |
Coordinates | 753141..753536 (+) | Length | 132 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDW91_RS03675 (748518) | 748518..748832 | - | 315 | WP_000958598.1 | putative quinol monooxygenase | - |
QDW91_RS03680 (748863) | 748863..749444 | - | 582 | WP_000065430.1 | NADPH:quinone oxidoreductase MdaB | - |
QDW91_RS03685 (749554) | 749554..750903 | - | 1350 | WP_000673406.1 | quorum sensing histidine kinase QseC | - |
QDW91_RS03690 (750900) | 750900..751559 | - | 660 | WP_001221491.1 | quorum sensing response regulator transcription factor QseB | - |
QDW91_RS03695 (751711) | 751711..752103 | + | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
QDW91_RS03700 (752156) | 752156..752638 | + | 483 | WP_000183498.1 | GyrI-like domain-containing protein | - |
QDW91_RS03705 (752843) | 752843..753139 | + | 297 | WP_000415584.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
QDW91_RS03710 (753141) | 753141..753536 | + | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
QDW91_RS03715 (753669) | 753669..755276 | + | 1608 | WP_001324265.1 | ABC transporter substrate-binding protein | - |
QDW91_RS03720 (755414) | 755414..757672 | + | 2259 | WP_001281881.1 | DNA topoisomerase IV subunit A | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 741115..753536 | 12421 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11231.96 Da Isoelectric Point: 8.9070
>T277779 WP_000415584.1 NZ_CP122722:752843-753139 [Escherichia coli]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT277779 WP_000650107.1 NZ_CP122722:753141-753536 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|