Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 4878707..4879309 | Replicon | chromosome |
| Accession | NZ_CP122719 | ||
| Organism | Escherichia coli strain ETEC1748 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U9XIS6 |
| Locus tag | QDW92_RS23975 | Protein ID | WP_000897305.1 |
| Coordinates | 4878998..4879309 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | QDW92_RS23970 | Protein ID | WP_000356395.1 |
| Coordinates | 4878707..4878997 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDW92_RS23935 (4874331) | 4874331..4875233 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
| QDW92_RS23940 (4875230) | 4875230..4875865 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
| QDW92_RS23945 (4875862) | 4875862..4876791 | + | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
| QDW92_RS23950 (4876973) | 4876973..4877215 | - | 243 | WP_001306649.1 | protein YiiF | - |
| QDW92_RS23955 (4877434) | 4877434..4877652 | - | 219 | WP_001295676.1 | CopG family transcriptional regulator | - |
| QDW92_RS23960 (4878071) | 4878071..4878349 | - | 279 | WP_001306650.1 | hypothetical protein | - |
| QDW92_RS23965 (4878401) | 4878401..4878622 | - | 222 | WP_001550354.1 | hypothetical protein | - |
| QDW92_RS23970 (4878707) | 4878707..4878997 | - | 291 | WP_000356395.1 | NadS family protein | Antitoxin |
| QDW92_RS23975 (4878998) | 4878998..4879309 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
| QDW92_RS23980 (4879538) | 4879538..4880446 | + | 909 | WP_001306651.1 | alpha/beta hydrolase | - |
| QDW92_RS23985 (4880615) | 4880615..4881529 | - | 915 | WP_225102955.1 | transposase | - |
| QDW92_RS23990 (4881542) | 4881542..4882429 | - | 888 | Protein_4690 | hypothetical protein | - |
| QDW92_RS23995 (4882845) | 4882845..4883786 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| QDW92_RS24000 (4883831) | 4883831..4884268 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T277774 WP_000897305.1 NZ_CP122719:c4879309-4878998 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|