Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 3995595..3996289 | Replicon | chromosome |
Accession | NZ_CP122719 | ||
Organism | Escherichia coli strain ETEC1748 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | A0A0D8WHS4 |
Locus tag | QDW92_RS19655 | Protein ID | WP_001521903.1 |
Coordinates | 3995595..3995993 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | L4JHF0 |
Locus tag | QDW92_RS19660 | Protein ID | WP_000554755.1 |
Coordinates | 3995996..3996289 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDW92_RS19625 (3990729) | 3990729..3992186 | + | 1458 | WP_001293009.1 | cytosol nonspecific dipeptidase | - |
QDW92_RS19630 (3992195) | 3992195..3992476 | + | 282 | WP_077881290.1 | hypothetical protein | - |
QDW92_RS19635 (3992493) | 3992493..3993002 | - | 510 | WP_063085380.1 | metal-dependent hydrolase | - |
QDW92_RS19640 (3993064) | 3993064..3993678 | - | 615 | WP_000602129.1 | peptide chain release factor H | - |
QDW92_RS19645 (3993675) | 3993675..3994814 | - | 1140 | WP_063085369.1 | RNA ligase RtcB family protein | - |
QDW92_RS19650 (3995133) | 3995133..3995585 | - | 453 | WP_001059858.1 | GNAT family N-acetyltransferase | - |
QDW92_RS19655 (3995595) | 3995595..3995993 | - | 399 | WP_001521903.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
QDW92_RS19660 (3995996) | 3995996..3996289 | - | 294 | WP_000554755.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
QDW92_RS19665 (3996341) | 3996341..3997396 | - | 1056 | WP_192297422.1 | DNA polymerase IV | - |
QDW92_RS19670 (3997467) | 3997467..3998252 | - | 786 | WP_074150236.1 | putative lateral flagellar export/assembly protein LafU | - |
QDW92_RS19675 (3998224) | 3998224..3999936 | + | 1713 | Protein_3855 | flagellar biosynthesis protein FlhA | - |
QDW92_RS19680 (4000041) | 4000041..4000319 | + | 279 | WP_000598760.1 | type II toxin-antitoxin system HicA family toxin | - |
QDW92_RS19685 (4000312) | 4000312..4000668 | + | 357 | WP_001030484.1 | type II toxin-antitoxin system HicB family antitoxin | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15471.88 Da Isoelectric Point: 8.0949
>T277770 WP_001521903.1 NZ_CP122719:c3995993-3995595 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGILPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGILPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0D8WHS4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829G9H5 |