Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 3995595..3996289 Replicon chromosome
Accession NZ_CP122719
Organism Escherichia coli strain ETEC1748

Toxin (Protein)


Gene name yafO Uniprot ID A0A0D8WHS4
Locus tag QDW92_RS19655 Protein ID WP_001521903.1
Coordinates 3995595..3995993 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID L4JHF0
Locus tag QDW92_RS19660 Protein ID WP_000554755.1
Coordinates 3995996..3996289 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDW92_RS19625 (3990729) 3990729..3992186 + 1458 WP_001293009.1 cytosol nonspecific dipeptidase -
QDW92_RS19630 (3992195) 3992195..3992476 + 282 WP_077881290.1 hypothetical protein -
QDW92_RS19635 (3992493) 3992493..3993002 - 510 WP_063085380.1 metal-dependent hydrolase -
QDW92_RS19640 (3993064) 3993064..3993678 - 615 WP_000602129.1 peptide chain release factor H -
QDW92_RS19645 (3993675) 3993675..3994814 - 1140 WP_063085369.1 RNA ligase RtcB family protein -
QDW92_RS19650 (3995133) 3995133..3995585 - 453 WP_001059858.1 GNAT family N-acetyltransferase -
QDW92_RS19655 (3995595) 3995595..3995993 - 399 WP_001521903.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
QDW92_RS19660 (3995996) 3995996..3996289 - 294 WP_000554755.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
QDW92_RS19665 (3996341) 3996341..3997396 - 1056 WP_192297422.1 DNA polymerase IV -
QDW92_RS19670 (3997467) 3997467..3998252 - 786 WP_074150236.1 putative lateral flagellar export/assembly protein LafU -
QDW92_RS19675 (3998224) 3998224..3999936 + 1713 Protein_3855 flagellar biosynthesis protein FlhA -
QDW92_RS19680 (4000041) 4000041..4000319 + 279 WP_000598760.1 type II toxin-antitoxin system HicA family toxin -
QDW92_RS19685 (4000312) 4000312..4000668 + 357 WP_001030484.1 type II toxin-antitoxin system HicB family antitoxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15471.88 Da        Isoelectric Point: 8.0949

>T277770 WP_001521903.1 NZ_CP122719:c3995993-3995595 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGILPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11235.78 Da        Isoelectric Point: 5.2170

>AT277770 WP_000554755.1 NZ_CP122719:c3996289-3995996 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKLVKARFRPSAARLEEITRRA
EQYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0D8WHS4

Antitoxin

Source ID Structure
AlphaFold DB A0A829G9H5

References