Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ralRA/- |
| Location | 2733483..2733854 | Replicon | chromosome |
| Accession | NZ_CP122719 | ||
| Organism | Escherichia coli strain ETEC1748 | ||
Toxin (Protein)
| Gene name | ralR | Uniprot ID | A0A839BBC2 |
| Locus tag | QDW92_RS13525 | Protein ID | WP_021500490.1 |
| Coordinates | 2733483..2733677 (+) | Length | 65 a.a. |
Antitoxin (RNA)
| Gene name | ralA | ||
| Locus tag | - | ||
| Coordinates | 2733676..2733854 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDW92_RS13505 (2728680) | 2728680..2728856 | + | 177 | WP_114499892.1 | YdaE family protein | - |
| QDW92_RS13510 (2728931) | 2728931..2729227 | + | 297 | WP_000022247.1 | hypothetical protein | - |
| QDW92_RS13515 (2729251) | 2729251..2732355 | + | 3105 | WP_282843181.1 | exodeoxyribonuclease VIII | - |
| QDW92_RS13520 (2732367) | 2732367..2733419 | + | 1053 | WP_282843182.1 | RecT family recombinase | - |
| QDW92_RS13525 (2733483) | 2733483..2733677 | + | 195 | WP_021500490.1 | type I toxin-antitoxin system endodeoxyribonuclease toxin RalR | Toxin |
| - (2733676) | 2733676..2733854 | - | 179 | NuclAT_1 | - | Antitoxin |
| - (2733676) | 2733676..2733854 | - | 179 | NuclAT_1 | - | Antitoxin |
| - (2733676) | 2733676..2733854 | - | 179 | NuclAT_1 | - | Antitoxin |
| - (2733676) | 2733676..2733854 | - | 179 | NuclAT_1 | - | Antitoxin |
| QDW92_RS13530 (2733670) | 2733670..2733858 | + | 189 | WP_001372676.1 | DUF1187 family protein | - |
| QDW92_RS13535 (2733958) | 2733958..2734173 | + | 216 | WP_000079604.1 | excisionase XisR | - |
| QDW92_RS13540 (2734175) | 2734175..2735410 | + | 1236 | WP_282843183.1 | site-specific integrase | - |
| QDW92_RS13545 (2735462) | 2735462..2736397 | + | 936 | WP_001157377.1 | tRNA 2-thiocytidine(32) synthetase TtcA | - |
| QDW92_RS13550 (2736526) | 2736526..2737899 | - | 1374 | WP_063085924.1 | ATP-dependent RNA helicase DbpA | - |
| QDW92_RS13555 (2737929) | 2737929..2738102 | - | 174 | WP_001296046.1 | protein YnaL | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2692272..2735410 | 43138 | |
| - | inside | Prophage | - | - | 2688054..2740847 | 52793 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 65 a.a. Molecular weight: 7046.98 Da Isoelectric Point: 9.2886
>T277763 WP_021500490.1 NZ_CP122719:2733483-2733677 [Escherichia coli]
MRYEKVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
MRYEKVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
Download Length: 195 bp
Antitoxin
Download Length: 179 bp
>AT277763 NZ_CP122719:c2733854-2733676 [Escherichia coli]
GAGGACTGAAGTTTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTCCCTGA
GAGCATTTTTTCGCATTCCGATTTGGTTAACTTTGTTTTTGAGTACCTTGTCCAGCTGGTAGGAGAACCACCTTCCTTTT
CAATAGTGGCGGTGATTTT
GAGGACTGAAGTTTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTCCCTGA
GAGCATTTTTTCGCATTCCGATTTGGTTAACTTTGTTTTTGAGTACCTTGTCCAGCTGGTAGGAGAACCACCTTCCTTTT
CAATAGTGGCGGTGATTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
