Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 4177692..4178386 Replicon chromosome
Accession NZ_CP122712
Organism Escherichia coli strain ETEC1749

Toxin (Protein)


Gene name yafO Uniprot ID A0A3A6T3I6
Locus tag QDX02_RS21215 Protein ID WP_001263490.1
Coordinates 4177692..4178090 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID S1FJN6
Locus tag QDX02_RS21220 Protein ID WP_000554757.1
Coordinates 4178093..4178386 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
- (4173352) 4173352..4173432 - 81 NuclAT_8 - -
- (4173352) 4173352..4173432 - 81 NuclAT_8 - -
- (4173352) 4173352..4173432 - 81 NuclAT_8 - -
- (4173352) 4173352..4173432 - 81 NuclAT_8 - -
QDX02_RS21185 (4172692) 4172692..4173936 - 1245 WP_000189541.1 esterase FrsA -
QDX02_RS21190 (4174028) 4174028..4174486 - 459 WP_001291990.1 xanthine phosphoribosyltransferase -
QDX02_RS21195 (4174747) 4174747..4176204 + 1458 WP_001293003.1 cytosol nonspecific dipeptidase -
QDX02_RS21200 (4176261) 4176261..4176782 - 522 Protein_4156 peptide chain release factor H -
QDX02_RS21205 (4176781) 4176781..4176984 - 204 Protein_4157 RtcB family protein -
QDX02_RS21210 (4177230) 4177230..4177682 - 453 WP_001059847.1 GNAT family N-acetyltransferase -
QDX02_RS21215 (4177692) 4177692..4178090 - 399 WP_001263490.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
QDX02_RS21220 (4178093) 4178093..4178386 - 294 WP_000554757.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
QDX02_RS21225 (4178438) 4178438..4179493 - 1056 WP_001226164.1 DNA polymerase IV -
QDX02_RS21230 (4179564) 4179564..4180349 - 786 WP_000207587.1 putative lateral flagellar export/assembly protein LafU -
QDX02_RS21235 (4180321) 4180321..4182033 + 1713 Protein_4163 flagellar biosynthesis protein FlhA -
QDX02_RS21240 (4182257) 4182257..4182754 - 498 WP_000006255.1 REP-associated tyrosine transposase RayT -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 4129942..4183556 53614


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15486.86 Da        Isoelectric Point: 8.0949

>T277739 WP_001263490.1 NZ_CP122712:c4178090-4177692 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLLYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11233.81 Da        Isoelectric Point: 5.9050

>AT277739 WP_000554757.1 NZ_CP122712:c4178386-4178093 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKPIKARFRPSAARLEEITRRA
EKYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3A6T3I6

Antitoxin

Source ID Structure
AlphaFold DB S1FJN6

References