Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1717524..1717738 Replicon chromosome
Accession NC_017906
Organism Escherichia coli Xuzhou21

Toxin (Protein)


Gene name ldrD Uniprot ID J7R083
Locus tag CDCO157_RS08875 Protein ID WP_000170963.1
Coordinates 1717524..1717631 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1717679..1717738 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
CDCO157_RS08845 1712833..1713915 + 1083 WP_000804726.1 peptide chain release factor 1 -
CDCO157_RS08850 1713915..1714748 + 834 WP_000456466.1 peptide chain release factor N(5)-glutamine methyltransferase -
CDCO157_RS08855 1714745..1715137 + 393 WP_000200379.1 invasion regulator SirB2 -
CDCO157_RS08860 1715141..1715950 + 810 WP_001257044.1 invasion regulator SirB1 -
CDCO157_RS08865 1715986..1716840 + 855 WP_000811067.1 3-deoxy-8-phosphooctulonate synthase -
CDCO157_RS08870 1716988..1717095 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
- 1717148..1717209 + 62 NuclAT_23 - -
- 1717148..1717209 + 62 NuclAT_23 - -
- 1717148..1717209 + 62 NuclAT_23 - -
- 1717148..1717209 + 62 NuclAT_23 - -
- 1717148..1717209 + 62 NuclAT_25 - -
- 1717148..1717209 + 62 NuclAT_25 - -
- 1717148..1717209 + 62 NuclAT_25 - -
- 1717148..1717209 + 62 NuclAT_25 - -
- 1717148..1717209 + 62 NuclAT_27 - -
- 1717148..1717209 + 62 NuclAT_27 - -
- 1717148..1717209 + 62 NuclAT_27 - -
- 1717148..1717209 + 62 NuclAT_27 - -
- 1717148..1717209 + 62 NuclAT_29 - -
- 1717148..1717209 + 62 NuclAT_29 - -
- 1717148..1717209 + 62 NuclAT_29 - -
- 1717148..1717209 + 62 NuclAT_29 - -
- 1717148..1717209 + 62 NuclAT_31 - -
- 1717148..1717209 + 62 NuclAT_31 - -
- 1717148..1717209 + 62 NuclAT_31 - -
- 1717148..1717209 + 62 NuclAT_31 - -
- 1717148..1717210 + 63 NuclAT_16 - -
- 1717148..1717210 + 63 NuclAT_16 - -
- 1717148..1717210 + 63 NuclAT_16 - -
- 1717148..1717210 + 63 NuclAT_16 - -
- 1717148..1717210 + 63 NuclAT_17 - -
- 1717148..1717210 + 63 NuclAT_17 - -
- 1717148..1717210 + 63 NuclAT_17 - -
- 1717148..1717210 + 63 NuclAT_17 - -
- 1717148..1717210 + 63 NuclAT_18 - -
- 1717148..1717210 + 63 NuclAT_18 - -
- 1717148..1717210 + 63 NuclAT_18 - -
- 1717148..1717210 + 63 NuclAT_18 - -
- 1717148..1717210 + 63 NuclAT_19 - -
- 1717148..1717210 + 63 NuclAT_19 - -
- 1717148..1717210 + 63 NuclAT_19 - -
- 1717148..1717210 + 63 NuclAT_19 - -
- 1717148..1717210 + 63 NuclAT_21 - -
- 1717148..1717210 + 63 NuclAT_21 - -
- 1717148..1717210 + 63 NuclAT_21 - -
- 1717148..1717210 + 63 NuclAT_21 - -
- 1717148..1717210 + 63 NuclAT_22 - -
- 1717148..1717210 + 63 NuclAT_22 - -
- 1717148..1717210 + 63 NuclAT_22 - -
- 1717148..1717210 + 63 NuclAT_22 - -
CDCO157_RS08875 1717524..1717631 - 108 WP_000170963.1 small toxic polypeptide LdrB Toxin
- 1717679..1717738 + 60 NuclAT_24 - Antitoxin
- 1717679..1717738 + 60 NuclAT_24 - Antitoxin
- 1717679..1717738 + 60 NuclAT_24 - Antitoxin
- 1717679..1717738 + 60 NuclAT_24 - Antitoxin
- 1717679..1717738 + 60 NuclAT_26 - Antitoxin
- 1717679..1717738 + 60 NuclAT_26 - Antitoxin
- 1717679..1717738 + 60 NuclAT_26 - Antitoxin
- 1717679..1717738 + 60 NuclAT_26 - Antitoxin
- 1717679..1717738 + 60 NuclAT_28 - Antitoxin
- 1717679..1717738 + 60 NuclAT_28 - Antitoxin
- 1717679..1717738 + 60 NuclAT_28 - Antitoxin
- 1717679..1717738 + 60 NuclAT_28 - Antitoxin
- 1717679..1717738 + 60 NuclAT_30 - Antitoxin
- 1717679..1717738 + 60 NuclAT_30 - Antitoxin
- 1717679..1717738 + 60 NuclAT_30 - Antitoxin
- 1717679..1717738 + 60 NuclAT_30 - Antitoxin
- 1717679..1717738 + 60 NuclAT_32 - Antitoxin
- 1717679..1717738 + 60 NuclAT_32 - Antitoxin
- 1717679..1717738 + 60 NuclAT_32 - Antitoxin
- 1717679..1717738 + 60 NuclAT_32 - Antitoxin
CDCO157_RS08880 1718030..1719130 - 1101 WP_001301956.1 sodium-potassium/proton antiporter ChaA -
CDCO157_RS08885 1719400..1719630 + 231 WP_001146444.1 putative cation transport regulator ChaB -
CDCO157_RS08890 1719791..1720486 + 696 WP_001301489.1 glutathione-specific gamma-glutamylcyclotransferase -
CDCO157_RS08895 1720530..1720883 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
CDCO157_RS08900 1721069..1722463 + 1395 WP_000086192.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3971.74 Da        Isoelectric Point: 11.4779

>T27773 WP_000170963.1 NC_017906:c1717631-1717524 [Escherichia coli Xuzhou21]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T27773 NC_017906:c1717631-1717524 [Escherichia coli Xuzhou21]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 60 bp

>AT27773 NC_017906:1717679-1717738 [Escherichia coli Xuzhou21]
GTCTGGTTTCAAGATTAGCCCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References