Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
| Location | 1155522..1156215 | Replicon | chromosome |
| Accession | NZ_CP122712 | ||
| Organism | Escherichia coli strain ETEC1749 | ||
Toxin (Protein)
| Gene name | mqsR | Uniprot ID | S1EZG2 |
| Locus tag | QDX02_RS05605 | Protein ID | WP_000415584.1 |
| Coordinates | 1155919..1156215 (-) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | mqsA | Uniprot ID | S1EBV2 |
| Locus tag | QDX02_RS05600 | Protein ID | WP_000650107.1 |
| Coordinates | 1155522..1155917 (-) | Length | 132 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDX02_RS05590 (1151386) | 1151386..1153644 | - | 2259 | WP_001281881.1 | DNA topoisomerase IV subunit A | - |
| QDX02_RS05595 (1153782) | 1153782..1155389 | - | 1608 | WP_001295629.1 | ABC transporter substrate-binding protein | - |
| QDX02_RS05600 (1155522) | 1155522..1155917 | - | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
| QDX02_RS05605 (1155919) | 1155919..1156215 | - | 297 | WP_000415584.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
| QDX02_RS05610 (1156420) | 1156420..1156902 | - | 483 | WP_000183505.1 | GyrI-like domain-containing protein | - |
| QDX02_RS05615 (1156955) | 1156955..1157347 | - | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
| QDX02_RS05620 (1157499) | 1157499..1158158 | + | 660 | WP_001221493.1 | quorum sensing response regulator transcription factor QseB | - |
| QDX02_RS05625 (1158155) | 1158155..1159504 | + | 1350 | WP_000673402.1 | quorum sensing histidine kinase QseC | - |
| QDX02_RS05630 (1159550) | 1159550..1159882 | - | 333 | WP_000917684.1 | DUF2645 family protein | - |
| QDX02_RS05635 (1160201) | 1160201..1160782 | + | 582 | WP_000065430.1 | NADPH:quinone oxidoreductase MdaB | - |
| QDX02_RS05640 (1160813) | 1160813..1161127 | + | 315 | WP_000958598.1 | putative quinol monooxygenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11231.96 Da Isoelectric Point: 8.9070
>T277721 WP_000415584.1 NZ_CP122712:c1156215-1155919 [Escherichia coli]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT277721 WP_000650107.1 NZ_CP122712:c1155917-1155522 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|