Detailed information of TA system TA277713

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 57900..58326
• Replicon: plasmid unnamed1
• Accession: NZ_CP122686
• Organism: Escherichia coli strain ETEC4067

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: QDX30_RS25415
• Protein ID: WP_001372321.1
• Coordinates: 58201..58326 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	57900..58124 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
QDX30_RS25375 (53610)	53610..53816	+	207	WP_000547945.1	hypothetical protein	-
QDX30_RS25380 (53842)	53842..54372	+	531	WP_032214168.1	single-stranded DNA-binding protein	-
QDX30_RS25385 (54428)	54428..54661	+	234	WP_000005971.1	DUF905 domain-containing protein	-
QDX30_RS25390 (54725)	54725..56683	+	1959	WP_282843141.1	ParB/RepB/Spo0J family partition protein	-
QDX30_RS25395 (56738)	56738..57172	+	435	WP_042634413.1	conjugation system SOS inhibitor PsiB	-
QDX30_RS25400 (57169)	57169..57931	+	763	Protein_72	plasmid SOS inhibition protein A	-
QDX30_RS25405 (57900)	57900..58088	-	189	WP_032084246.1	hypothetical protein	-
- (58057)	58057..58122	+	66	NuclAT_1	-	-
- (57900)	57900..58124	+	225	NuclAT_0	-	Antitoxin
- (57900)	57900..58124	+	225	NuclAT_0	-	Antitoxin
- (57900)	57900..58124	+	225	NuclAT_0	-	Antitoxin
- (57900)	57900..58124	+	225	NuclAT_0	-	Antitoxin
- (57900)	57900..58124	-	225	NuclAT_0	-	-
QDX30_RS25410 (58110)	58110..58259	+	150	Protein_74	plasmid maintenance protein Mok	-
QDX30_RS25415 (58201)	58201..58326	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
QDX30_RS25420 (58546)	58546..58776	+	231	WP_001426396.1	hypothetical protein	-
QDX30_RS25425 (58774)	58774..58947	-	174	Protein_77	hypothetical protein	-
QDX30_RS25430 (59017)	59017..59223	+	207	WP_000547968.1	hypothetical protein	-
QDX30_RS25435 (59248)	59248..59535	+	288	WP_000107535.1	hypothetical protein	-
QDX30_RS25440 (59653)	59653..60474	+	822	WP_001234469.1	DUF932 domain-containing protein	-
QDX30_RS25445 (60771)	60771..61373	-	603	WP_000243703.1	transglycosylase SLT domain-containing protein	-
QDX30_RS25450 (61696)	61696..62079	+	384	WP_001428424.1	conjugal transfer relaxosome DNA-binding protein TraM	-
QDX30_RS25455 (62272)	62272..62943	+	672	WP_032083167.1	conjugal transfer transcriptional regulator TraJ	-
QDX30_RS25460 (63080)	63080..63307	+	228	WP_000089265.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	-	-	1..67634	67634

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T277713 WP_001372321.1 NZ_CP122686:58201-58326 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT277713 NZ_CP122686:57900-58124 [Escherichia coli]
TCACATGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin