Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 4890559..4891161 | Replicon | chromosome |
| Accession | NZ_CP122685 | ||
| Organism | Escherichia coli strain ETEC4067 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U9XIS6 |
| Locus tag | QDX30_RS24070 | Protein ID | WP_000897305.1 |
| Coordinates | 4890850..4891161 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | QDX30_RS24065 | Protein ID | WP_000356395.1 |
| Coordinates | 4890559..4890849 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDX30_RS24030 (4886183) | 4886183..4887085 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
| QDX30_RS24035 (4887082) | 4887082..4887717 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
| QDX30_RS24040 (4887714) | 4887714..4888643 | + | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
| QDX30_RS24045 (4888825) | 4888825..4889067 | - | 243 | WP_001306649.1 | protein YiiF | - |
| QDX30_RS24050 (4889286) | 4889286..4889504 | - | 219 | WP_001295676.1 | CopG family transcriptional regulator | - |
| QDX30_RS24055 (4889923) | 4889923..4890201 | - | 279 | WP_001306650.1 | hypothetical protein | - |
| QDX30_RS24060 (4890253) | 4890253..4890474 | - | 222 | WP_001550354.1 | hypothetical protein | - |
| QDX30_RS24065 (4890559) | 4890559..4890849 | - | 291 | WP_000356395.1 | NadS family protein | Antitoxin |
| QDX30_RS24070 (4890850) | 4890850..4891161 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
| QDX30_RS24075 (4891390) | 4891390..4892298 | + | 909 | WP_001306651.1 | alpha/beta hydrolase | - |
| QDX30_RS24080 (4892467) | 4892467..4893381 | - | 915 | WP_225102955.1 | transposase | - |
| QDX30_RS24085 (4893394) | 4893394..4894281 | - | 888 | Protein_4708 | hypothetical protein | - |
| QDX30_RS24090 (4894697) | 4894697..4895638 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| QDX30_RS24095 (4895683) | 4895683..4896120 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T277711 WP_000897305.1 NZ_CP122685:c4891161-4890850 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|