Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 3994709..3995403 Replicon chromosome
Accession NZ_CP122685
Organism Escherichia coli strain ETEC4067

Toxin (Protein)


Gene name yafO Uniprot ID A0A0D8WHS4
Locus tag QDX30_RS19665 Protein ID WP_001521903.1
Coordinates 3994709..3995107 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID L4JHF0
Locus tag QDX30_RS19670 Protein ID WP_000554755.1
Coordinates 3995110..3995403 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDX30_RS19635 (3989843) 3989843..3991300 + 1458 WP_001293009.1 cytosol nonspecific dipeptidase -
QDX30_RS19640 (3991309) 3991309..3991590 + 282 WP_077881290.1 hypothetical protein -
QDX30_RS19645 (3991607) 3991607..3992116 - 510 WP_063085380.1 metal-dependent hydrolase -
QDX30_RS19650 (3992178) 3992178..3992792 - 615 WP_000602129.1 peptide chain release factor H -
QDX30_RS19655 (3992789) 3992789..3993928 - 1140 WP_063085369.1 RNA ligase RtcB family protein -
QDX30_RS19660 (3994247) 3994247..3994699 - 453 WP_001059858.1 GNAT family N-acetyltransferase -
QDX30_RS19665 (3994709) 3994709..3995107 - 399 WP_001521903.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
QDX30_RS19670 (3995110) 3995110..3995403 - 294 WP_000554755.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
QDX30_RS19675 (3995455) 3995455..3996510 - 1056 WP_192297422.1 DNA polymerase IV -
QDX30_RS19680 (3996581) 3996581..3997366 - 786 WP_074150236.1 putative lateral flagellar export/assembly protein LafU -
QDX30_RS19685 (3997338) 3997338..3999050 + 1713 Protein_3856 flagellar biosynthesis protein FlhA -
QDX30_RS19690 (3999155) 3999155..3999433 + 279 WP_000598760.1 type II toxin-antitoxin system HicA family toxin -
QDX30_RS19695 (3999426) 3999426..3999782 + 357 WP_001030484.1 type II toxin-antitoxin system HicB family antitoxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15471.88 Da        Isoelectric Point: 8.0949

>T277708 WP_001521903.1 NZ_CP122685:c3995107-3994709 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGILPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11235.78 Da        Isoelectric Point: 5.2170

>AT277708 WP_000554755.1 NZ_CP122685:c3995403-3995110 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKLVKARFRPSAARLEEITRRA
EQYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0D8WHS4

Antitoxin

Source ID Structure
AlphaFold DB A0A829G9H5

References