Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4775116..4775718 | Replicon | chromosome |
Accession | NZ_CP122681 | ||
Organism | Escherichia coli strain ETEC4068 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | QDW67_RS23275 | Protein ID | WP_000897305.1 |
Coordinates | 4775407..4775718 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | QDW67_RS23270 | Protein ID | WP_000356395.1 |
Coordinates | 4775116..4775406 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDW67_RS23235 (4770740) | 4770740..4771642 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
QDW67_RS23240 (4771639) | 4771639..4772274 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
QDW67_RS23245 (4772271) | 4772271..4773200 | + | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
QDW67_RS23250 (4773382) | 4773382..4773624 | - | 243 | WP_001306649.1 | protein YiiF | - |
QDW67_RS23255 (4773843) | 4773843..4774061 | - | 219 | WP_001295676.1 | CopG family transcriptional regulator | - |
QDW67_RS23260 (4774480) | 4774480..4774758 | - | 279 | WP_001306650.1 | hypothetical protein | - |
QDW67_RS23265 (4774810) | 4774810..4775031 | - | 222 | WP_001550354.1 | hypothetical protein | - |
QDW67_RS23270 (4775116) | 4775116..4775406 | - | 291 | WP_000356395.1 | NadS family protein | Antitoxin |
QDW67_RS23275 (4775407) | 4775407..4775718 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
QDW67_RS23280 (4775947) | 4775947..4776855 | + | 909 | WP_001306651.1 | alpha/beta hydrolase | - |
QDW67_RS23285 (4777024) | 4777024..4777938 | - | 915 | WP_225102955.1 | transposase | - |
QDW67_RS23290 (4777951) | 4777951..4778838 | - | 888 | Protein_4549 | hypothetical protein | - |
QDW67_RS23295 (4779254) | 4779254..4780195 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
QDW67_RS23300 (4780240) | 4780240..4780677 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T277692 WP_000897305.1 NZ_CP122681:c4775718-4775407 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|