Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 3939933..3940627 Replicon chromosome
Accession NZ_CP122681
Organism Escherichia coli strain ETEC4068

Toxin (Protein)


Gene name yafO Uniprot ID A0A0D8WHS4
Locus tag QDW67_RS19270 Protein ID WP_001521903.1
Coordinates 3939933..3940331 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID L4JHF0
Locus tag QDW67_RS19275 Protein ID WP_000554755.1
Coordinates 3940334..3940627 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDW67_RS19240 (3935067) 3935067..3936524 + 1458 WP_001293009.1 cytosol nonspecific dipeptidase -
QDW67_RS19245 (3936533) 3936533..3936814 + 282 WP_077881290.1 hypothetical protein -
QDW67_RS19250 (3936831) 3936831..3937340 - 510 WP_063085380.1 metal-dependent hydrolase -
QDW67_RS19255 (3937402) 3937402..3938016 - 615 WP_000602129.1 peptide chain release factor H -
QDW67_RS19260 (3938013) 3938013..3939152 - 1140 WP_063085369.1 RNA ligase RtcB family protein -
QDW67_RS19265 (3939471) 3939471..3939923 - 453 WP_001059858.1 GNAT family N-acetyltransferase -
QDW67_RS19270 (3939933) 3939933..3940331 - 399 WP_001521903.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
QDW67_RS19275 (3940334) 3940334..3940627 - 294 WP_000554755.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
QDW67_RS19280 (3940679) 3940679..3941734 - 1056 WP_001226166.1 DNA polymerase IV -
QDW67_RS19285 (3941805) 3941805..3942590 - 786 WP_074150236.1 putative lateral flagellar export/assembly protein LafU -
QDW67_RS19290 (3942562) 3942562..3944274 + 1713 Protein_3776 flagellar biosynthesis protein FlhA -
QDW67_RS19295 (3944379) 3944379..3944657 + 279 WP_000598760.1 type II toxin-antitoxin system HicA family toxin -
QDW67_RS19300 (3944650) 3944650..3945006 + 357 WP_001030484.1 type II toxin-antitoxin system HicB family antitoxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15471.88 Da        Isoelectric Point: 8.0949

>T277689 WP_001521903.1 NZ_CP122681:c3940331-3939933 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGILPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11235.78 Da        Isoelectric Point: 5.2170

>AT277689 WP_000554755.1 NZ_CP122681:c3940627-3940334 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKLVKARFRPSAARLEEITRRA
EQYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0D8WHS4

Antitoxin

Source ID Structure
AlphaFold DB A0A829G9H5

References