Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 620924..621723 | Replicon | chromosome |
| Accession | NZ_CP122681 | ||
| Organism | Escherichia coli strain ETEC4068 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | A0A3A6SBL4 |
| Locus tag | QDW67_RS02995 | Protein ID | WP_062875446.1 |
| Coordinates | 620924..621388 (-) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | S1EB98 |
| Locus tag | QDW67_RS03000 | Protein ID | WP_001307405.1 |
| Coordinates | 621388..621723 (-) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDW67_RS02965 (615925) | 615925..616359 | - | 435 | WP_063086247.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
| QDW67_RS02970 (616377) | 616377..617255 | - | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
| QDW67_RS02975 (617245) | 617245..618024 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
| QDW67_RS02980 (618035) | 618035..618508 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| QDW67_RS02985 (618531) | 618531..619811 | - | 1281 | WP_063086249.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| QDW67_RS02990 (620060) | 620060..620869 | + | 810 | WP_000072171.1 | aga operon transcriptional regulator AgaR | - |
| QDW67_RS02995 (620924) | 620924..621388 | - | 465 | WP_062875446.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| QDW67_RS03000 (621388) | 621388..621723 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| QDW67_RS03005 (621872) | 621872..623443 | - | 1572 | WP_001273756.1 | galactarate dehydratase | - |
| QDW67_RS03010 (623818) | 623818..625152 | + | 1335 | WP_000599651.1 | galactarate/glucarate/glycerate transporter GarP | - |
| QDW67_RS03015 (625168) | 625168..625943 | + | 776 | Protein_589 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 620924..632217 | 11293 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17844.22 Da Isoelectric Point: 9.4942
>T277674 WP_062875446.1 NZ_CP122681:c621388-620924 [Escherichia coli]
MDFPQRVNSWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETD
MDFPQRVNSWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETD
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3A6SBL4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XVC7 |