Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4889970..4890572 | Replicon | chromosome |
Accession | NZ_CP122679 | ||
Organism | Escherichia coli strain ETEC4069 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | QDW53_RS24205 | Protein ID | WP_000897305.1 |
Coordinates | 4890261..4890572 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | QDW53_RS24200 | Protein ID | WP_000356395.1 |
Coordinates | 4889970..4890260 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDW53_RS24165 (4885594) | 4885594..4886496 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
QDW53_RS24170 (4886493) | 4886493..4887128 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
QDW53_RS24175 (4887125) | 4887125..4888054 | + | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
QDW53_RS24180 (4888236) | 4888236..4888478 | - | 243 | WP_001306649.1 | protein YiiF | - |
QDW53_RS24185 (4888697) | 4888697..4888915 | - | 219 | WP_001295676.1 | CopG family transcriptional regulator | - |
QDW53_RS24190 (4889334) | 4889334..4889612 | - | 279 | WP_001306650.1 | hypothetical protein | - |
QDW53_RS24195 (4889664) | 4889664..4889885 | - | 222 | WP_001550354.1 | hypothetical protein | - |
QDW53_RS24200 (4889970) | 4889970..4890260 | - | 291 | WP_000356395.1 | NadS family protein | Antitoxin |
QDW53_RS24205 (4890261) | 4890261..4890572 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
QDW53_RS24210 (4890801) | 4890801..4891709 | + | 909 | WP_001306651.1 | alpha/beta hydrolase | - |
QDW53_RS24215 (4891878) | 4891878..4892792 | - | 915 | WP_225102955.1 | transposase | - |
QDW53_RS24220 (4892805) | 4892805..4893692 | - | 888 | Protein_4736 | hypothetical protein | - |
QDW53_RS24225 (4894108) | 4894108..4895049 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
QDW53_RS24230 (4895094) | 4895094..4895531 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T277672 WP_000897305.1 NZ_CP122679:c4890572-4890261 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|